PPP2R5B (protein phosphatase 2 regulatory subunit B'beta)

Gene

• Entrez ID: 5526
• Gene name: Protein phosphatase 2 regulatory subunit B'beta
• Gene symbol: PPP2R5B
• Synonyms: B56B, B56beta, PR61B
• Chromosome: 11
• Chromosome location: 11q13.1
• Summary: The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a beta isoform of the regulatory subunit B56 subfamily. [provided by RefSeq, Jul 2008]

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000159	Component	Protein phosphatase type 2A complex	IBA	21873635
GO:0005515	Function	Protein binding	IPI	7592815, 15380617, 16456541, 18782753, 28330616, 30595372, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	TAS	8703017
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006470	Process	Protein dephosphorylation	IBA	21873635
GO:0010469	Process	Regulation of signaling receptor activity	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0014066	Process	Regulation of phosphatidylinositol 3-kinase signaling	TAS
GO:0019888	Function	Protein phosphatase regulator activity	TAS	8703017
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IEA
GO:0031952	Process	Regulation of protein autophosphorylation	IBA	21873635
GO:0036498	Process	IRE1-mediated unfolded protein response	TAS
GO:0043666	Process	Regulation of phosphoprotein phosphatase activity	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0050730	Process	Regulation of peptidyl-tyrosine phosphorylation	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IEA
GO:0051388	Process	Positive regulation of neurotrophin TRK receptor signaling pathway	IEA
GO:0051898	Process	Negative regulation of protein kinase B signaling	TAS
GO:0070317	Process	Negative regulation of G0 to G1 transition	IEA
GO:0071158	Process	Positive regulation of cell cycle arrest	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0072542	Function	Protein phosphatase activator activity	IBA	21873635

Other IDs

• MIM: 601644
• HGNC: 9310
• e!Ensembl: ENSG00000068971

Protein

• UniProt ID: Q15173
• Protein name: Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform (PP2A B subunit isoform B'-beta) (PP2A B subunit isoform B56-beta) (PP2A B subunit isoform PR61-beta) (PP2A B subunit isoform R5-beta)
• Protein function: As the regulatory component of the serine/threonine-protein phosphatase 2A (PP2A) holoenzyme, modulates substrate specificity, subcellular localization, and responsiveness to phosphorylation. The phosphorylated form mediates the interaction between PP2A and AKT1, leading to AKT1 dephosphorylation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01603	B56	62 → 467	Protein phosphatase 2A regulatory B subunit (B56 family)	Family

• Sequence:

  METKLPPASTPTSPSSPGLSPVPPPDKVDGFSRRSLRRARPRRSHSSSQFRYQSNQQELT
  PLPLLKDVPASELHELLSRKLAQCGVMFDFLDCVADLKGKEVKRAALNELVECVGSTRGV
  LIEPVYPDIIRMISVNIFRTLPPSENPEFDPEEDEPNLEPSWPHLQLVYEFFLRFLESPD
  FQPSVAKRYVDQKFVLMLLELFDSEDPREREYLKTILHRVYGKFLGLRAYIRKQCNHIFL
  RFIYEFEHFNGVAELLEILGSIINGFALPLKTEHKQFLVRVLIPLHSVKSLSVFHAQLAY
  CVVQFLEKDATLTEHVIRGLLKYWPKTCTQKEVMFLGEMEEILDVIEPSQFVKIQEPLFK
  QVARCVSSPHFQVAERALYFWNNEYILSLIEDNCHTVLPAVFGTLYQVSKEHWNQTIVSL
  IYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKE
  APLQRLTPQVAASGGQS

• Sequence length: 497