PPP2R5A (protein phosphatase 2 regulatory subunit B'alpha)

Gene

• Entrez ID: 5525
• Gene name: Protein phosphatase 2 regulatory subunit B'alpha
• Gene symbol: PPP2R5A
• Synonyms: B56A, B56alpha, PR61A
• Chromosome: 1
• Chromosome location: 1q32.3
• Summary: The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B56 subfamily. Alternative transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2010]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004602	hsa-miR-1-3p	Luciferase reporter assay, Western blot	19131648
MIRT016181	hsa-miR-590-3p	Sequencing	20371350
MIRT018236	hsa-miR-335-5p	Microarray	18185580
MIRT042199	hsa-miR-484	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000159	Component	Protein phosphatase type 2A complex	IBA	21873635
GO:0000159	Component	Protein phosphatase type 2A complex	IDA	17245430
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	IDA	24157919
GO:0005515	Function	Protein binding	IPI	7592815, 9847399, 15380617, 16097049, 16541025, 17245430, 17540176, 18782753, 21878643, 24157919, 26496610, 28330616, 28514442, 30595372, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	21075214
GO:0005813	Component	Centrosome	IDA	24157919
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0006470	Process	Protein dephosphorylation	IBA	21873635
GO:0006470	Process	Protein dephosphorylation	IDA	24157919
GO:0007165	Process	Signal transduction	IEA
GO:0016020	Component	Membrane	IDA	15569306
GO:0019888	Function	Protein phosphatase regulator activity	TAS	8703017
GO:0019900	Function	Kinase binding	IPI	21075214
GO:0030018	Component	Z disc	IDA	19131648
GO:0031430	Component	M band	ISS	18782775
GO:0031952	Process	Regulation of protein autophosphorylation	IBA	21873635
GO:0035307	Process	Positive regulation of protein dephosphorylation	IMP	21075214
GO:0043666	Process	Regulation of phosphoprotein phosphatase activity	IEA
GO:0072542	Function	Protein phosphatase activator activity	IBA	21873635
GO:0090219	Process	Negative regulation of lipid kinase activity	IMP	21075214
GO:1903077	Process	Negative regulation of protein localization to plasma membrane	IMP	21075214

Other IDs

• MIM: 601643
• HGNC: 9309
• e!Ensembl: ENSG00000066027

Protein

• UniProt ID: Q15172
• Protein name: Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform (PP2A B subunit isoform B'-alpha) (PP2A B subunit isoform B56-alpha) (PP2A B subunit isoform PR61-alpha) (PR61alpha) (PP2A B subunit isoform R5-alpha)
• Protein function: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
• PDB: 6NTS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01603	B56	56 → 462	Protein phosphatase 2A regulatory B subunit (B56 family)	Family

• Sequence:

  MSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQAELHPLPQLK
  DATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAY
  SDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIA
  KRYIDQKFVQQLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYET
  EHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFL
  EKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKCV
  SSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLK
  TLMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALEKQNSAYNMHSIL
  SNTSAE

• Sequence length: 486