PPP2R3C (protein phosphatase 2 regulatory subunit B''gamma)

Gene

• Entrez ID: 55012
• Gene name: Protein phosphatase 2 regulatory subunit B''gamma
• Gene symbol: PPP2R3C
• Synonyms: C14orf10, G4-1, G5pr, GDRM, MEGD, SPGF36
• Chromosome: 14
• Chromosome location: 14q13.2
• Summary: This gene encodes a regulatory subunit of the serine/threonine phosphatase, protein phosphatase 2. This protein is localized to both nuclear and cytoplasmic regions depending on cell cycle phase. Homozygous conditional knockout mice for this gene exhibit

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019852	hsa-miR-375	Microarray	20215506
MIRT1257767	hsa-miR-103a	CLIP-seq
MIRT1257768	hsa-miR-107	CLIP-seq
MIRT1257769	hsa-miR-4484	CLIP-seq
MIRT1257770	hsa-miR-4666-5p	CLIP-seq
MIRT1257771	hsa-miR-548an	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IBA	21873635
GO:0001782	Process	B cell homeostasis	IBA	21873635
GO:0002759	Process	Regulation of antimicrobial humoral response	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005813	Component	Centrosome	IBA	21873635
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005819	Component	Spindle	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0030865	Process	Cortical cytoskeleton organization	IBA	21873635
GO:0032147	Process	Activation of protein kinase activity	IEA
GO:0035303	Process	Regulation of dephosphorylation	IEA
GO:0043029	Process	T cell homeostasis	IBA	21873635
GO:0045579	Process	Positive regulation of B cell differentiation	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA
GO:0048536	Process	Spleen development	IEA
GO:0051900	Process	Regulation of mitochondrial depolarization	IEA

Other IDs

• MIM: 615902
• HGNC: 17485
• e!Ensembl: ENSG00000092020

Protein

• UniProt ID: Q969Q6
• Protein name: Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma (Protein phosphatase subunit G5PR) (Rhabdomyosarcoma antigen MU-RMS-40.6A/6C)
• Protein function: May regulate MCM3AP phosphorylation through phosphatase recruitment (By similarity). May act as a negative regulator of ABCB1 expression and function through the dephosphorylation of ABCB1 by TFPI2/PPP2R3C complex (PubMed:24333728). May play a r
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17958	EF-hand_13	173 → 259	EF-hand domain	Domain

• Sequence:

  MDWKEVLRRRLATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFY
  YRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINY
  ENFLKVGEKAGAKCKQFFTAKVFAKLLHTDSYGRISIMQFFNYVMRKVWLHQTRIGLSLY
  DVAGQGYLRESDLENYILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKI
  QDILACSFLDDLLELRDEELSKESQETNWFSAPSALRVYGQYLNLDKDHNGMLSKEELSR
  YGTATMTNVFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIFKLLDIENKGY
  LNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTV
  TTILIDLNGFWTYENREALVANDSENSADLDDT

• Sequence length: 453