PPP2R3B (protein phosphatase 2 regulatory subunit B''beta)

Gene

• Entrez ID: 28227
• Gene name: Protein phosphatase 2 regulatory subunit B''beta
• Gene symbol: PPP2R3B
• Synonyms: NYREN8, PPP2R3L, PPP2R3LY, PR48, PR70
• Chromosome: X|Y
• Chromosome location: X;Y
• Summary: Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B`/PR61, and B``/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B`` family. The B`` family has been further divided into subfamilies. The product of this gene belongs to the beta subfamily of regulatory subunit B``. [provided by RefSeq, Apr 2010]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024826	hsa-miR-215-5p	Microarray	19074876
MIRT026231	hsa-miR-192-5p	Microarray	19074876

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000159	Component	Protein phosphatase type 2A complex	IBA	21873635
GO:0000159	Component	Protein phosphatase type 2A complex	ISS
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	9847399, 21516116, 25416956, 27812135, 32296183
GO:0005634	Component	Nucleus	TAS	10629059
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006470	Process	Protein dephosphorylation	IBA	21873635
GO:0006470	Process	Protein dephosphorylation	ISS
GO:0007050	Process	Cell cycle arrest	TAS	10629059
GO:0019888	Function	Protein phosphatase regulator activity	IBA	21873635
GO:0019888	Function	Protein phosphatase regulator activity	ISS
GO:0043666	Process	Regulation of phosphoprotein phosphatase activity	IEA

Other IDs

• MIM: 300339
• HGNC: 13417
• e!Ensembl: ENSG00000167393

Protein

• UniProt ID: Q9Y5P8
• Protein name: Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta (PP2A subunit B isoform PR48) (Protein phosphatase 2A 48 kDa regulatory subunit)
• Protein function: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
• PDB: 4I5L, 4I5N, 4MEW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17958	EF-hand_13	212 → 301	EF-hand domain	Domain
  PF13499	EF-hand_7	316 → 418	EF-hand domain pair	Domain

• Sequence:

  MPPGKVLQPVLKMKVDELFLYWLSEASTQRMLQDCLRRIKAPGRDQPTPGDGEQPGAWPT
  APLAAPRPSGLEPPGTPGPGPALPLGAASSPRNAPHVRGTRRSAGTRVVQTRKEEPLPPA
  TSQSIPTFYFPRGRPQDSVNVDAVISKIESTFARFPHERATMDDMGLVAKACGCPLYWKG
  PLFYGAGGERTGSVSVHKFVAMWRKILQNCHDDAAKFVHLLMSPGCNYLVQEDFVPFLQD
  VVNTHPGLSFLKEASEFHSRYITTVIQRIFYAVNRSWSGRITCAELRRSSFLQNVALLEE
  EADINQLTEFFSYEHFYVIYCKFWELDTDHDLLIDADDLARHNDHALSTKMIDRIFSGAV
  TRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQ
  CRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDH
  EQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSA
  LRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL

• Sequence length: 575