GediPNet logo

PPP2R2A (protein phosphatase 2 regulatory subunit Balpha)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5520
Gene nameGene Name - the full gene name approved by the HGNC.
Protein phosphatase 2 regulatory subunit Balpha
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
PPP2R2A
SynonymsGene synonyms aliases
B55, B55A, B55ALPHA, PR52A, PR55A, PR55alpha
ChromosomeChromosome number
8
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p21.2
SummarySummary of gene provided in NCBI Entrez Gene.
The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heter
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000490 hsa-miR-31-5p qRT-PCR, Luciferase reporter assay 20237410
MIRT003191 hsa-miR-222-3p Luciferase reporter assay, Western blot 20103675
MIRT003191 hsa-miR-222-3p Luciferase reporter assay, Western blot 20103675
MIRT020735 hsa-miR-155-5p Proteomics 18668040
MIRT023787 hsa-miR-1-3p Proteomics 18668040
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000086 Process G2/M transition of mitotic cell cycle TAS
GO:0000159 Component Protein phosphatase type 2A complex IBA 21873635
GO:0000159 Component Protein phosphatase type 2A complex IDA 1849734, 17245430
GO:0000184 Process Nuclear-transcribed mRNA catabolic process, nonsense-mediated decay TAS
GO:0005515 Function Protein binding IPI 9847399, 15761952, 17245430, 17529992, 17540176, 17632056, 18782753, 19156129, 19293187, 19915589, 20711181, 25816751, 26496610, 26894577, 27173435, 27588481, 28330616, 28609714, 30595372, 30611118, 31046837, 32814053, 33108758
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P63151
Protein name Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform (PP2A subunit B isoform B55-alpha) (B55) (PP2A subunit B isoform PR55-alpha) (PP2A subunit B isoform R2-alpha) (PP2A subunit B isoform alpha)
Protein function Substrate-recognition subunit of protein phosphatase 2A (PP2A) that plays a key role in cell cycle by controlling mitosis entry and exit (PubMed:1849734, PubMed:33108758). Involved in chromosome clustering during late mitosis by mediating dephos
PDB 3DW8 , 8SO0 , 8TTB , 8TWE
Family and domains
Sequence
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQE
NKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIK
LWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHI
NSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCN
TFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYM
MTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTG
SYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKIL
HTAWHPKENIIAVATTNNLYIFQDKVN
Sequence length 447
Interactions View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412