PPP2CB (protein phosphatase 2 catalytic subunit beta)

Gene

• Entrez ID: 5516
• Gene name: Protein phosphatase 2 catalytic subunit beta
• Gene symbol: PPP2CB
• Synonyms: PP2Abeta, PP2CB
• Chromosome: 8
• Chromosome location: 8p12
• Summary: This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes a beta isoform of the catalytic subunit. [provided by RefSeq, Mar 2010]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016657	hsa-miR-425-5p	Sequencing	20371350
MIRT016657	hsa-miR-425-5p	PAR-CLIP	21572407
MIRT039452	hsa-miR-421	CLASH	23622248
MIRT438391	hsa-miR-183-5p	Luciferase reporter assay, Western blot, qRT-PCR	25152390
MIRT439916	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT555316	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT555317	hsa-miR-549a	PAR-CLIP	21572407
MIRT555318	hsa-miR-302d-5p	PAR-CLIP	21572407
MIRT555319	hsa-miR-302b-5p	PAR-CLIP	21572407
MIRT555320	hsa-miR-6814-5p	PAR-CLIP	21572407
MIRT555321	hsa-miR-130b-5p	PAR-CLIP	21572407
MIRT555322	hsa-miR-216b-5p	PAR-CLIP	21572407
MIRT555323	hsa-miR-548b-3p	PAR-CLIP	21572407
MIRT555324	hsa-miR-150-5p	PAR-CLIP	21572407

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000159	Component	Protein phosphatase type 2A complex	TAS	8206937
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000922	Component	Spindle pole	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	ISS
GO:0004722	Function	Protein serine/threonine phosphatase activity	TAS	10640627, 16262633
GO:0004722	Function	Protein serine/threonine phosphatase activity	TAS	8206937
GO:0005515	Function	Protein binding	IPI	9647778, 10698523, 18782753, 19156129, 20969868, 21784977, 25531779, 26496610, 28514442, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006470	Process	Protein dephosphorylation	TAS	2849765
GO:0008022	Function	Protein C-terminus binding	IEA
GO:0008637	Process	Apoptotic mitochondrial changes	IEA
GO:0010288	Process	Response to lead ion	ISS
GO:0010468	Process	Regulation of gene expression	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0035970	Process	Peptidyl-threonine dephosphorylation	TAS	16262633
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0046580	Process	Negative regulation of Ras protein signal transduction	IEA
GO:0046677	Process	Response to antibiotic	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0070262	Process	Peptidyl-serine dephosphorylation	TAS	16262633
GO:0106306	Function	Protein serine phosphatase activity	IEA
GO:0106307	Function	Protein threonine phosphatase activity	IEA
GO:1904528	Process	Positive regulation of microtubule binding	ISS

Other IDs

• MIM: 176916
• HGNC: 9300
• e!Ensembl: ENSG00000104695

Protein

• UniProt ID: P62714
• Protein name: Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PP2A-beta) (EC 3.1.3.16)
• Protein function: PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00149	Metallophos	50 → 245	Calcineurin-like phosphoesterase	Domain

• Sequence:

  MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
  QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
  RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
  RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
  HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
  TRRTPDYFL

• Sequence length: 309