PPP1CC (protein phosphatase 1 catalytic subunit gamma)

Gene

• Entrez ID: 5501
• Gene name: Protein phosphatase 1 catalytic subunit gamma
• Gene symbol: PPP1CC
• Synonyms: PP-1G, PP1C, PPP1G
• Chromosome: 12
• Chromosome location: 12q24.11
• Summary: The protein encoded by this gene belongs to the protein phosphatase family, PP1 subfamily. PP1 is an ubiquitous serine/threonine phosphatase that regulates many cellular processes, including cell division. It is expressed in mammalian cells as three closely related isoforms, alpha, beta/delta and gamma, which have distinct localization patterns. This gene encodes the gamma isozyme. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028665	hsa-miR-30a-5p	Proteomics	18668040
MIRT036628	hsa-miR-940	CLASH	23622248
MIRT045316	hsa-miR-185-5p	CLASH	23622248
MIRT046498	hsa-miR-15b-5p	CLASH	23622248
MIRT049174	hsa-miR-92a-3p	CLASH	23622248
MIRT050049	hsa-miR-26b-5p	CLASH	23622248
MIRT050065	hsa-miR-26a-5p	CLASH	23622248
MIRT335190	hsa-miR-3646	PAR-CLIP	23592263
MIRT335190	hsa-miR-3646	PAR-CLIP	20371350
MIRT335191	hsa-miR-3662	PAR-CLIP	23592263
MIRT335191	hsa-miR-3662	PAR-CLIP	20371350
MIRT335214	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT335214	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT335228	hsa-miR-466	PAR-CLIP	23592263
MIRT335228	hsa-miR-466	PAR-CLIP	20371350
MIRT335231	hsa-miR-4643	PAR-CLIP	23592263
MIRT335231	hsa-miR-4643	PAR-CLIP	20371350
MIRT470517	hsa-miR-190a-3p	PAR-CLIP	23592263
MIRT470517	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT470518	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT470518	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT470519	hsa-miR-493-3p	PAR-CLIP	23592263
MIRT470519	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT470520	hsa-miR-302a-5p	PAR-CLIP	23592263
MIRT470520	hsa-miR-302a-5p	PAR-CLIP	20371350
MIRT470521	hsa-miR-6504-3p	PAR-CLIP	23592263
MIRT470521	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT470522	hsa-miR-154-5p	PAR-CLIP	23592263
MIRT470522	hsa-miR-154-5p	PAR-CLIP	20371350
MIRT470523	hsa-miR-5684	PAR-CLIP	23592263
MIRT470523	hsa-miR-5684	PAR-CLIP	20371350
MIRT470524	hsa-miR-323a-3p	PAR-CLIP	23592263
MIRT470524	hsa-miR-323a-3p	PAR-CLIP	20371350
MIRT470525	hsa-miR-4789-3p	PAR-CLIP	23592263
MIRT470525	hsa-miR-4789-3p	PAR-CLIP	20371350
MIRT470526	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT470526	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT555376	hsa-miR-4279	PAR-CLIP	21572407
MIRT555377	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT555377	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT555378	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT555378	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT555379	hsa-miR-8075	PAR-CLIP	21572407
MIRT555379	hsa-miR-8075	PAR-CLIP	20371350
MIRT555380	hsa-miR-6770-5p	PAR-CLIP	21572407
MIRT555381	hsa-miR-1253	PAR-CLIP	21572407
MIRT555382	hsa-miR-4699-5p	PAR-CLIP	21572407
MIRT555383	hsa-miR-4251	PAR-CLIP	21572407
MIRT555384	hsa-miR-1976	PAR-CLIP	21572407
MIRT555385	hsa-miR-3653-5p	PAR-CLIP	21572407
MIRT555386	hsa-miR-1914-5p	PAR-CLIP	21572407
MIRT555386	hsa-miR-1914-5p	PAR-CLIP	20371350
MIRT555387	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT555387	hsa-miR-3121-3p	PAR-CLIP	20371350
MIRT555388	hsa-miR-218-5p	PAR-CLIP	21572407
MIRT555388	hsa-miR-218-5p	PAR-CLIP	20371350
MIRT566299	hsa-miR-6882-5p	PAR-CLIP	20371350
MIRT654822	hsa-miR-510-3p	HITS-CLIP	23824327
MIRT654823	hsa-miR-3148	HITS-CLIP	23824327
MIRT654824	hsa-miR-494-3p	HITS-CLIP	23824327
MIRT654825	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT654826	hsa-miR-6866-3p	HITS-CLIP	23824327
MIRT654827	hsa-miR-188-5p	HITS-CLIP	23824327
MIRT654828	hsa-miR-6859-5p	HITS-CLIP	23824327
MIRT654829	hsa-miR-3125	HITS-CLIP	23824327
MIRT654830	hsa-miR-3916	HITS-CLIP	23824327
MIRT654831	hsa-miR-548e-5p	HITS-CLIP	23824327
MIRT654832	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT654833	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT735142	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26111201

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000164	Component	Protein phosphatase type 1 complex	IEA
GO:0000777	Component	Condensed chromosome kinetochore	IEA
GO:0000781	Component	Chromosome, telomeric region	IDA	24270157
GO:0003723	Function	RNA binding	HDA	22681889
GO:0004721	Function	Phosphoprotein phosphatase activity	TAS
GO:0004722	Function	Protein serine/threonine phosphatase activity	IBA	21873635
GO:0004722	Function	Protein serine/threonine phosphatase activity	IMP	10880350, 17936702
GO:0005515	Function	Protein binding	IPI	10807923, 11739654, 12761178, 15231748, 17274640, 17511879, 17936702, 17965019, 18448430, 20516061, 20926688, 21397856, 21988832, 21998301, 23414517, 23555304, 24366813, 25416956, 25785436, 26307080, 26496610, 27173435, 27505673, 27913189, 28065597, 28330616, 29892012, 31527615, 322
GO:0005521	Function	Lamin binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	11739654
GO:0005730	Component	Nucleolus	IDA	11739654
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	11739654
GO:0005739	Component	Mitochondrion	IDA	17936702
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005977	Process	Glycogen metabolic process	IEA
GO:0006470	Process	Protein dephosphorylation	IMP	22801782
GO:0006470	Process	Protein dephosphorylation	ISS
GO:0007049	Process	Cell cycle	IEA
GO:0008022	Function	Protein C-terminus binding	IEA
GO:0008157	Function	Protein phosphatase 1 binding	IEA
GO:0016607	Component	Nuclear speck	IEA
GO:0016791	Function	Phosphatase activity	ISS
GO:0019901	Function	Protein kinase binding	IPI	10880350
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030496	Component	Midbody	IEA
GO:0032154	Component	Cleavage furrow	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0032991	Component	Protein-containing complex	IMP	10880350
GO:0042752	Process	Regulation of circadian rhythm	IMP	21712997
GO:0043153	Process	Entrainment of circadian clock by photoperiod	ISS
GO:0043197	Component	Dendritic spine	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0046822	Process	Regulation of nucleocytoplasmic transport	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0047485	Function	Protein N-terminus binding	IDA	23789093
GO:0051301	Process	Cell division	IEA
GO:0060252	Process	Positive regulation of glial cell proliferation	IEA
GO:0072357	Component	PTW/PP1 phosphatase complex	IDA	20516061
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0106306	Function	Protein serine phosphatase activity	IEA
GO:0106307	Function	Protein threonine phosphatase activity	IEA

Other IDs

• MIM: 176914
• HGNC: 9283
• e!Ensembl: ENSG00000186298

Protein

• UniProt ID: P36873
• Protein name: Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PP-1G) (EC 3.1.3.16) (Protein phosphatase 1C catalytic subunit)
• Protein function: Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Dephosphorylates RPS6KB1. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca(2+)/calmodulin dependent protein kinase II. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. May dephosphorylate CSNK1D and CSNK1E. Dephosphorylates the 'Ser-418' residue of FOXP3 in regulatory T-cells (Treg) from patients with rheumatoid arthritis, thereby inactivating FOXP3 and rendering Treg cells functionally defective (PubMed:23396208).
• PDB: 1IT6, 1JK7, 1U32, 2BCD, 2BDX, 4UT2, 4UT3, 5INB, 5J28
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16891	STPPase_N	9 → 56	Serine-threonine protein phosphatase N-terminal domain	Family
  PF00149	Metallophos	57 → 252	Calcineurin-like phosphoesterase	Domain

• Sequence:

  MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
  ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
  LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
  QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
  LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
  KKKPNATRPVTPPRGMITKQAKK

• Sequence length: 323