PPP1CB (protein phosphatase 1 catalytic subunit beta)

Gene

• Entrez ID: 5500
• Gene name: Protein phosphatase 1 catalytic subunit beta
• Gene symbol: PPP1CB
• Synonyms: HEL-S-80p, MP, NSLH2, PP-1B, PP1B, PP1beta, PP1c, PPP1CD, PPP1beta
• Chromosome: 2
• Chromosome location: 2p23.2
• Summary: The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs886037952	C>G	Pathogenic	Coding sequence variant, missense variant
rs886037953	G>T	Likely-pathogenic	Coding sequence variant, missense variant
rs886037954	A>C,T	Pathogenic	Coding sequence variant, missense variant
rs886037955	G>A	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1114167429	G>C	Pathogenic	Missense variant, coding sequence variant
rs1553310744	C>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1553311527	C>T	Likely-pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024868	hsa-miR-215-5p	Microarray	19074876
MIRT026142	hsa-miR-192-5p	Microarray	19074876
MIRT031341	hsa-miR-18a-5p	Sequencing	20371350
MIRT040166	hsa-miR-615-3p	CLASH	23622248
MIRT040560	hsa-miR-92b-3p	CLASH	23622248
MIRT041041	hsa-miR-505-3p	CLASH	23622248
MIRT046264	hsa-miR-23b-3p	CLASH	23622248
MIRT046516	hsa-miR-15b-5p	CLASH	23622248
MIRT206304	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT206320	hsa-miR-3148	PAR-CLIP	21572407
MIRT206323	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT206325	hsa-miR-5584-5p	PAR-CLIP	21572407
MIRT206332	hsa-miR-4503	PAR-CLIP	22012620
MIRT302383	hsa-miR-7856-5p	PAR-CLIP	22012620
MIRT377094	hsa-miR-548t-3p	HITS-CLIP	19536157
MIRT377095	hsa-miR-548aa	HITS-CLIP	19536157
MIRT377096	hsa-miR-548ap-3p	HITS-CLIP	19536157
MIRT377097	hsa-miR-548as-3p	HITS-CLIP	19536157
MIRT377098	hsa-miR-548at-3p	HITS-CLIP	19536157
MIRT377099	hsa-miR-548ay-3p	HITS-CLIP	19536157
MIRT389126	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT437757	hsa-miR-99a-5p	Microarray, qRT-PCR	22815788
MIRT437758	hsa-miR-99b-5p	Microarray, qRT-PCR	22815788
MIRT437759	hsa-miR-100-5p	Microarray, qRT-PCR	22815788
MIRT535075	hsa-miR-607	PAR-CLIP	22012620
MIRT535076	hsa-miR-3671	PAR-CLIP	22012620
MIRT535077	hsa-miR-100-3p	PAR-CLIP	22012620
MIRT547018	hsa-miR-203a-3p	PAR-CLIP	21572407
MIRT547019	hsa-miR-4776-3p	PAR-CLIP	21572407
MIRT547020	hsa-miR-2909	PAR-CLIP	21572407
MIRT547021	hsa-miR-4659b-5p	PAR-CLIP	21572407
MIRT547022	hsa-miR-4659a-5p	PAR-CLIP	21572407
MIRT547023	hsa-miR-5590-5p	PAR-CLIP	21572407
MIRT547024	hsa-miR-3162-5p	PAR-CLIP	21572407
MIRT547025	hsa-miR-9500	PAR-CLIP	21572407
MIRT547026	hsa-miR-6822-5p	PAR-CLIP	21572407
MIRT547027	hsa-miR-6750-5p	PAR-CLIP	21572407
MIRT712261	hsa-miR-542-5p	HITS-CLIP	19536157
MIRT712262	hsa-miR-452-3p	HITS-CLIP	19536157
MIRT712263	hsa-miR-466	HITS-CLIP	19536157
MIRT712264	hsa-miR-4672	HITS-CLIP	19536157
MIRT712265	hsa-miR-3941	HITS-CLIP	19536157
MIRT712266	hsa-miR-3160-5p	HITS-CLIP	19536157
MIRT712267	hsa-miR-3134	HITS-CLIP	19536157
MIRT712268	hsa-miR-5683	HITS-CLIP	19536157
MIRT712269	hsa-miR-6768-5p	HITS-CLIP	19536157
MIRT712270	hsa-miR-497-3p	HITS-CLIP	19536157
MIRT712271	hsa-miR-323a-3p	HITS-CLIP	19536157
MIRT721605	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT721606	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT721607	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT721608	hsa-miR-4799-5p	HITS-CLIP	19536157
MIRT721609	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT721610	hsa-miR-2117	HITS-CLIP	19536157
MIRT721611	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT721612	hsa-miR-1248	HITS-CLIP	19536157
MIRT721613	hsa-miR-1237-3p	HITS-CLIP	19536157
MIRT721614	hsa-miR-148a-5p	HITS-CLIP	19536157
MIRT721615	hsa-miR-4668-3p	HITS-CLIP	19536157

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0000164	Component	Protein phosphatase type 1 complex	IEA
GO:0000781	Component	Chromosome, telomeric region	IDA	24270157
GO:0004722	Function	Protein serine/threonine phosphatase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	11067852, 17511879, 18586956, 20424263, 20516061, 20926688, 21516116, 21998301, 23414517, 23555304, 25416956, 25544563, 25785436, 25910212, 26496610, 26871637, 27107012, 27173435, 28296156, 28330616, 28514442, 32296183, 32814053
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005977	Process	Glycogen metabolic process	IEA
GO:0005979	Process	Regulation of glycogen biosynthetic process	IEA
GO:0005981	Process	Regulation of glycogen catabolic process	IEA
GO:0006470	Process	Protein dephosphorylation	ISS
GO:0016791	Function	Phosphatase activity	ISS
GO:0017018	Function	Myosin phosphatase activity	ISS
GO:0019901	Function	Protein kinase binding	IPI	20354225
GO:0030155	Process	Regulation of cell adhesion	IDA	20354225
GO:0032922	Process	Circadian regulation of gene expression	IBA	21873635
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0042587	Component	Glycogen granule	IEA
GO:0042752	Process	Regulation of circadian rhythm	IBA	21873635
GO:0042752	Process	Regulation of circadian rhythm	IMP	21712997
GO:0043153	Process	Entrainment of circadian clock by photoperiod	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0050115	Function	Myosin-light-chain-phosphatase activity	IDA	20354225
GO:0051301	Process	Cell division	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0072357	Component	PTW/PP1 phosphatase complex	IDA	20354225, 20516061
GO:0106306	Function	Protein serine phosphatase activity	IEA
GO:0106307	Function	Protein threonine phosphatase activity	IEA

Other IDs

• MIM: 600590
• HGNC: 9282
• e!Ensembl: ENSG00000213639

Protein

• UniProt ID: P62140
• Protein name: Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PP-1B) (PPP1CD) (EC 3.1.3.16) (EC 3.1.3.53)
• Protein function: Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. May dephosphorylate CSNK1D and CSNK1E. Dephosphorylates the 'Ser-418' residue of FOXP3 in regulatory T-cells (Treg) from patients with rheumatoid arthritis, thereby inactivating FOXP3 and rendering Treg cells functionally defective (PubMed:23396208).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16891	STPPase_N	8 → 55	Serine-threonine protein phosphatase N-terminal domain	Family
  PF00149	Metallophos	56 → 251	Calcineurin-like phosphoesterase	Domain

• Sequence:

  MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
  CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
  RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
  SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
  DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
  KAKYQYGGLNSGRPVTPPRTANPPKKR

• Sequence length: 327