POPDC3 (popeye domain containing 3)

Gene

• Entrez ID: 64208
• Gene name: Popeye domain containing 3
• Gene symbol: POPDC3
• Synonyms: LGMDR26, POP3, bA355M14.1
• Chromosome: 6
• Chromosome location: 6q21
• Summary: This gene encodes a member of the POP family of proteins containing three putative transmembrane domains. This gene is expressed in cardiac and skeletal muscle and may play an important role in these tissues during development. Alternatively spliced transcript variants have been found. [provided by RefSeq, Nov 2008]

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003674	Function	Molecular_function	ND
GO:0007507	Process	Heart development	IBA	21873635
GO:0007519	Process	Skeletal muscle tissue development	IBA	21873635
GO:0008150	Process	Biological_process	ND
GO:0016021	Component	Integral component of membrane	NAS	10882522
GO:0030552	Function	CAMP binding	IBA	21873635
GO:0030552	Function	CAMP binding	ISS
GO:0042383	Component	Sarcolemma	IBA	21873635
GO:0042391	Process	Regulation of membrane potential	IBA	21873635
GO:0042391	Process	Regulation of membrane potential	ISS
GO:0051146	Process	Striated muscle cell differentiation	IBA	21873635

Other IDs

• MIM: 605824
• HGNC: 17649
• e!Ensembl: ENSG00000132429

Protein

• UniProt ID: Q9HBV1
• Protein name: Popeye domain-containing protein 3 (Popeye protein 3)
• Protein function: May play a role in the maintenance of heart function mediated, at least in part, through cAMP-binding. May play a role in the regulation of KCNK2/TREK-1-mediated current amplitude (PubMed:31610034).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04831	Popeye	25 → 249	Popeye protein conserved region	Family

• Sequence:

  MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLG
  FLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLG
  ISLPVFRTIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPLQF
  LDSPEWDSLRPTEEGIFQVTLTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIA
  DKLYALNDRVYIGKRYHYDIRLPNFYQMSTPEIRRSPLTQHFQNSRRYCDK

• Sequence length: 291