PLN (phospholamban)

Gene

• Entrez ID: 5350
• Gene name: Phospholamban
• Gene symbol: PLN
• Synonyms: CMD1P, CMH18, PLB
• Chromosome: 6
• Chromosome location: 6q22.31
• Summary: The protein encoded by this gene is found as a pentamer and is a major substrate for the cAMP-dependent protein kinase in cardiac muscle. The encoded protein is an inhibitor of cardiac muscle sarcoplasmic reticulum Ca(2+)-ATPase in the unphosphorylated state, but inhibition is relieved upon phosphorylation of the protein. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. The encoded protein is a key regulator of cardiac diastolic function. Mutations in this gene are a cause of inherited human dilated cardiomyopathy with refractory congestive heart failure, and also familial hypertrophic cardiomyopathy. [provided by RefSeq, Apr 2016]

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002026	Process	Regulation of the force of heart contraction	IC	19708671
GO:0004857	Function	Enzyme inhibitor activity	ISS	12032137
GO:0005515	Function	Protein binding	IPI	15598648, 24722188, 25416956, 25910212, 31515488, 32296183
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0006816	Process	Calcium ion transport	IEA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0008015	Process	Blood circulation	NAS	8406504
GO:0008016	Process	Regulation of heart contraction	IMP	16432188
GO:0010043	Process	Response to zinc ion	IEA
GO:0010459	Process	Negative regulation of heart rate	IMP	16432188
GO:0010881	Process	Regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion	IEA
GO:0016020	Component	Membrane	IDA	19708671
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0031982	Component	Vesicle	IEA
GO:0032780	Process	Negative regulation of ATPase activity	IDA	19708671
GO:0032780	Process	Negative regulation of ATPase activity	ISS
GO:0032868	Process	Response to insulin	IEA
GO:0033017	Component	Sarcoplasmic reticulum membrane	ISS
GO:0033017	Component	Sarcoplasmic reticulum membrane	TAS
GO:0033574	Process	Response to testosterone	IEA
GO:0042030	Function	ATPase inhibitor activity	IDA	19708671
GO:0042030	Function	ATPase inhibitor activity	ISS
GO:0042802	Function	Identical protein binding	ISS
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043086	Process	Negative regulation of catalytic activity	ISS	12032137
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048738	Process	Cardiac muscle tissue development	IEA
GO:0051117	Function	ATPase binding	ISS	12032137
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IC	19708671
GO:0051924	Process	Regulation of calcium ion transport	IDA	22427649
GO:0051924	Process	Regulation of calcium ion transport	ISS
GO:0051926	Process	Negative regulation of calcium ion transport	IDA	19708671
GO:0055119	Process	Relaxation of cardiac muscle	TAS	22679139
GO:0060314	Process	Regulation of ryanodine-sensitive calcium-release channel activity	IEA
GO:0086004	Process	Regulation of cardiac muscle cell contraction	IC	19708671
GO:0086023	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway involved in heart process	IEA
GO:0086036	Process	Regulation of cardiac muscle cell membrane potential	IC	19708671
GO:0086092	Process	Regulation of the force of heart contraction by cardiac conduction	IEA
GO:0090281	Process	Negative regulation of calcium ion import	ISS	12032137
GO:0090534	Component	Calcium ion-transporting ATPase complex	IDA	19708671
GO:1901020	Process	Negative regulation of calcium ion transmembrane transporter activity	IDA	19708671
GO:1901020	Process	Negative regulation of calcium ion transmembrane transporter activity	ISS	12032137
GO:1901877	Process	Negative regulation of calcium ion binding	IDA	19708671
GO:1901877	Process	Negative regulation of calcium ion binding	ISS	12032137
GO:1901894	Process	Regulation of ATPase-coupled calcium transmembrane transporter activity	IDA	22427649
GO:1901895	Process	Negative regulation of ATPase-coupled calcium transmembrane transporter activity	IDA	19708671
GO:1901897	Process	Regulation of relaxation of cardiac muscle	IC	19708671
GO:1902081	Process	Negative regulation of calcium ion import into sarcoplasmic reticulum	ISS

Other IDs

• MIM: 172405
• HGNC: 9080
• e!Ensembl: ENSG00000198523

Protein

• UniProt ID: P26678
• Protein name: Cardiac phospholamban (PLB)
• Protein function: Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+) (PubMed:28890335). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation.
• PDB: 1K9N, 1KCH, 1PLN, 1PLP, 1PSL, 1ZLL, 2HYN, 6Y40
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04272	Phospholamban	1 → 52	Phospholamban	Domain

• Sequence:

  MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL

• Sequence length: 52