PLN (phospholamban)

Gene

• Entrez ID: 5350
• Gene name: Phospholamban
• Gene symbol: PLN
• Synonyms: CMD1P, CMH18, PLB
• Chromosome: 6
• Chromosome location: 6q22.31
• Summary: The protein encoded by this gene is found as a pentamer and is a major substrate for the cAMP-dependent protein kinase in cardiac muscle. The encoded protein is an inhibitor of cardiac muscle sarcoplasmic reticulum Ca(2+)-ATPase in the unphosphorylated st

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1242996	hsa-miR-4753-3p	CLIP-seq
MIRT1242997	hsa-miR-4768-5p	CLIP-seq
MIRT2071803	hsa-miR-4263	CLIP-seq
MIRT1242996	hsa-miR-4753-3p	CLIP-seq
MIRT1242997	hsa-miR-4768-5p	CLIP-seq
MIRT2071804	hsa-miR-4773	CLIP-seq
MIRT2071805	hsa-miR-4799-5p	CLIP-seq
MIRT2071806	hsa-miR-576-5p	CLIP-seq
MIRT2071804	hsa-miR-4773	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002026	Process	Regulation of the force of heart contraction	IC	19708671
GO:0004857	Function	Enzyme inhibitor activity	ISS	12032137
GO:0005515	Function	Protein binding	IPI	15598648, 24722188, 25416956, 25910212, 31515488, 32296183
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0006816	Process	Calcium ion transport	IEA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0008015	Process	Blood circulation	NAS	8406504
GO:0008016	Process	Regulation of heart contraction	IMP	16432188
GO:0010043	Process	Response to zinc ion	IEA
GO:0010459	Process	Negative regulation of heart rate	IMP	16432188
GO:0010881	Process	Regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion	IEA
GO:0016020	Component	Membrane	IDA	19708671
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0031982	Component	Vesicle	IEA
GO:0032780	Process	Negative regulation of ATPase activity	IDA	19708671
GO:0032780	Process	Negative regulation of ATPase activity	ISS
GO:0032868	Process	Response to insulin	IEA
GO:0033017	Component	Sarcoplasmic reticulum membrane	ISS
GO:0033017	Component	Sarcoplasmic reticulum membrane	TAS
GO:0033574	Process	Response to testosterone	IEA
GO:0042030	Function	ATPase inhibitor activity	IDA	19708671
GO:0042030	Function	ATPase inhibitor activity	ISS
GO:0042802	Function	Identical protein binding	ISS
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043086	Process	Negative regulation of catalytic activity	ISS	12032137
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048738	Process	Cardiac muscle tissue development	IEA
GO:0051117	Function	ATPase binding	ISS	12032137
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IC	19708671
GO:0051924	Process	Regulation of calcium ion transport	IDA	22427649
GO:0051924	Process	Regulation of calcium ion transport	ISS
GO:0051926	Process	Negative regulation of calcium ion transport	IDA	19708671
GO:0055119	Process	Relaxation of cardiac muscle	TAS	22679139
GO:0060314	Process	Regulation of ryanodine-sensitive calcium-release channel activity	IEA
GO:0086004	Process	Regulation of cardiac muscle cell contraction	IC	19708671
GO:0086023	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway involved in heart process	IEA
GO:0086036	Process	Regulation of cardiac muscle cell membrane potential	IC	19708671
GO:0086092	Process	Regulation of the force of heart contraction by cardiac conduction	IEA
GO:0090281	Process	Negative regulation of calcium ion import	ISS	12032137
GO:0090534	Component	Calcium ion-transporting ATPase complex	IDA	19708671
GO:1901020	Process	Negative regulation of calcium ion transmembrane transporter activity	IDA	19708671
GO:1901020	Process	Negative regulation of calcium ion transmembrane transporter activity	ISS	12032137
GO:1901877	Process	Negative regulation of calcium ion binding	IDA	19708671
GO:1901877	Process	Negative regulation of calcium ion binding	ISS	12032137
GO:1901894	Process	Regulation of ATPase-coupled calcium transmembrane transporter activity	IDA	22427649
GO:1901895	Process	Negative regulation of ATPase-coupled calcium transmembrane transporter activity	IDA	19708671
GO:1901897	Process	Regulation of relaxation of cardiac muscle	IC	19708671
GO:1902081	Process	Negative regulation of calcium ion import into sarcoplasmic reticulum	ISS

Other IDs

• MIM: 172405
• HGNC: 9080
• e!Ensembl: ENSG00000198523

Protein

• UniProt ID: P26678
• Protein name: Phospholamban (PLB)
• Protein function: Reversibly inhibits the activity of ATP2A2/SERCA2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+) (PubMed:28890335). Binds preferentially to the ATP-bound E1 conformational form of ATP2A2 which pred
• PDB: 1PLP, 1ZLL, 2HYN, 6Y40, 7E0Z, 7E11, 7E12
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04272	Phospholamban	1 → 52	Phospholamban	Domain

• Sequence:

  MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL

• Sequence length: 52