PLCD4 (phospholipase C delta 4)

Gene

• Entrez ID: 84812
• Gene name: Phospholipase C delta 4
• Gene symbol: PLCD4
• Synonyms: -
• Chromosome: 2
• Chromosome location: 2q35
• Summary: This gene encodes a member of the delta class of phospholipase C enzymes. Phospholipase C enzymes play a critical role in many cellular processes by hydrolyzing phosphatidylinositol 4,5-bisphosphate into two intracellular second messengers, inositol 1,4,5-trisphosphate and diacylglycerol. Expression of this gene may be a marker for cancer. [provided by RefSeq, Jan 2011]

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004435	Function	Phosphatidylinositol phospholipase C activity	IBA	21873635
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0007340	Process	Acrosome reaction	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0043647	Process	Inositol phosphate metabolic process	TAS
GO:0046488	Process	Phosphatidylinositol metabolic process	IEA
GO:0048015	Process	Phosphatidylinositol-mediated signaling	IBA	21873635
GO:0050790	Process	Regulation of catalytic activity	IEA

Other IDs

• MIM: 605939
• HGNC: 9062
• e!Ensembl: ENSG00000115556

Protein

• UniProt ID: Q9BRC7
• Protein name: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 (hPLCD4) (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-4) (Phospholipase C-delta-4) (PLC-delta-4)
• Protein function: Hydrolyzes the phosphatidylinositol 4,5-bisphosphate (PIP2) to generate 2 second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). DAG mediates the activation of protein kinase C (PKC), while IP3 releases Ca(2+) from intracellular stores. Required for acrosome reaction in sperm during fertilization, probably by acting as an important enzyme for intracellular Ca(2+) mobilization in the zona pellucida-induced acrosome reaction. May play a role in cell growth. Modulates the liver regeneration in cooperation with nuclear PKC. Overexpression up-regulates the Erk signaling pathway and proliferation. ; [Isoform 2]: Acts as a non-receptor guanine nucleotide exchange factor which binds to and activates guanine nucleotide-binding protein (G-protein) alpha subunit GNAI3.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00169	PH	17 → 124	PH domain	Domain
  PF09279	EF-hand_like	198 → 283	Phosphoinositide-specific phospholipase C, efhand-like	Domain
  PF00388	PI-PLC-X	292 → 436	Phosphatidylinositol-specific phospholipase C, X domain	Family
  PF00387	PI-PLC-Y	493 → 607	Phosphatidylinositol-specific phospholipase C, Y domain	Family
  PF00168	C2	627 → 736	C2 domain	Domain

• Sequence:

  MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPS
  FSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRSNLDLMANSVEEAQIWMRGLQ
  LLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLHLMNVEMDQEYAFSLFQ
  AADTSQSGTLEGEEFVQFYKALTKRAEVQELFESFSADGQKLTLLEFLDFLQEEQKERDC
  TSELALELIDRYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQDMTQPLNHYF
  ICSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDVWDGPSGEPVVYHGHTLTSRILF
  KDVVATVAQYAFQTSDYPVILSLETHCSWEQQQTMARHLTEILGEQLLSTTLDGVLPTQL
  PSPEELRRKILVKGKKLTLEEDLEYEEEEAEPELEESELALESQFETEPEPQEQNLQNKD
  KKKKSKPILCPALSSLVIYLKSVSFRSFTHSKEHYHFYEISSFSETKAKRLIKEAGNEFV
  QHNTWQLSRVYPSGLRTDSSNYNPQELWNAGCQMVAMNMQTAGLEMDICDGHFRQNGGCG
  YVLKPDFLRDIQSSFHPEKPISPFKAQTLLIQVISGQQLPKVDKTKEGSIVDPLVKVQIF
  GVRLDTARQETNYVENNGFNPYWGQTLCFRVLVPELAMLRFVVMDYDWKSRNDFIGQYTL
  PWTCMQQGYRHIHLLSKDGISLRPASIFVYICIQEGLEGDES

• Sequence length: 762