PIM2 (Pim-2 proto-oncogene, serine/threonine kinase)

Gene

• Entrez ID: 11040
• Gene name: Pim-2 proto-oncogene, serine/threonine kinase
• Gene symbol: PIM2
• Synonyms: -
• Chromosome: X
• Chromosome location: Xp11.23
• Summary: This gene encodes a protooncogene that acts as a serine/threonine protein kinase. Studies determined the encoded protein functions to prevent apoptosis and to promote cell survival.[provided by RefSeq, Nov 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030307	hsa-miR-26b-5p	Microarray	19088304
MIRT030617	hsa-miR-24-3p	Sequencing	20371350
MIRT036440	hsa-miR-1226-3p	CLASH	23622248
MIRT471056	hsa-miR-4516	PAR-CLIP	23592263
MIRT471057	hsa-miR-5703	PAR-CLIP	23592263
MIRT471058	hsa-miR-4434	PAR-CLIP	23592263
MIRT471059	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT471060	hsa-miR-8064	PAR-CLIP	23592263
MIRT471061	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT471062	hsa-miR-1253	PAR-CLIP	23592263
MIRT471063	hsa-miR-4673	PAR-CLIP	23592263
MIRT471064	hsa-miR-4645-5p	PAR-CLIP	23592263
MIRT471065	hsa-miR-4514	PAR-CLIP	23592263
MIRT471066	hsa-miR-4692	PAR-CLIP	23592263
MIRT471067	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT471068	hsa-miR-940	PAR-CLIP	23592263
MIRT471069	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT471070	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT471071	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT471072	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT471073	hsa-miR-5197-3p	PAR-CLIP	23592263

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	20307683
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	18593906
GO:0005515	Function	Protein binding	IPI	16713569, 25416956, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0006468	Process	Protein phosphorylation	IDA	18593906
GO:0006468	Process	Protein phosphorylation	ISS
GO:0006915	Process	Apoptotic process	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IBA	21873635
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	20307683
GO:0009615	Process	Response to virus	IEP	16548883
GO:0010508	Process	Positive regulation of autophagy	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IBA	21873635
GO:0043066	Process	Negative regulation of apoptotic process	IDA	18675992
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	ISS
GO:0045893	Process	Positive regulation of transcription, DNA-templated	ISS
GO:0046777	Process	Protein autophosphorylation	IBA	21873635
GO:0050821	Process	Protein stabilization	IMP	20307683
GO:0050821	Process	Protein stabilization	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA

Other IDs

• MIM: 300295
• HGNC: 8987
• e!Ensembl: ENSG00000102096

Protein

• UniProt ID: Q9P1W9
• Protein name: Serine/threonine-protein kinase pim-2 (EC 2.7.11.1) (Pim-2h)
• Protein function: Proto-oncogene with serine/threonine kinase activity involved in cell survival and cell proliferation. Exerts its oncogenic activity through: the regulation of MYC transcriptional activity, the regulation of cell cycle progression, the regulation of cap-dependent protein translation and through survival signaling by phosphorylation of a pro-apoptotic protein, BAD. Phosphorylation of MYC leads to an increase of MYC protein stability and thereby an increase transcriptional activity. The stabilization of MYC exerted by PIM2 might explain partly the strong synergism between these 2 oncogenes in tumorigenesis. Regulates cap-dependent protein translation in a mammalian target of rapamycin complex 1 (mTORC1)-independent manner and in parallel to the PI3K-Akt pathway. Mediates survival signaling through phosphorylation of BAD, which induces release of the anti-apoptotic protein Bcl-X(L)/BCL2L1. Promotes cell survival in response to a variety of proliferative signals via positive regulation of the I-kappa-B kinase/NF-kappa-B cascade; this process requires phosphorylation of MAP3K8/COT. Promotes growth factor-independent proliferation by phosphorylation of cell cycle factors such as CDKN1A and CDKN1B. Involved in the positive regulation of chondrocyte survival and autophagy in the epiphyseal growth plate.
• PDB: 2IWI, 4X7Q
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	32 → 286	Protein kinase domain	Domain

• Sequence:

  MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
  KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
  PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
  IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
  DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
  GPAPLAWSLLP

• Sequence length: 311