PIM2 (Pim-2 proto-oncogene, serine/threonine kinase)

Gene

• Entrez ID: 11040
• Gene name: Pim-2 proto-oncogene, serine/threonine kinase
• Gene symbol: PIM2
• Synonyms: -
• Chromosome: X
• Chromosome location: Xp11.23
• Summary: This gene encodes a protooncogene that acts as a serine/threonine protein kinase. Studies determined the encoded protein functions to prevent apoptosis and to promote cell survival.[provided by RefSeq, Nov 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030307	hsa-miR-26b-5p	Microarray	19088304
MIRT030617	hsa-miR-24-3p	Sequencing	20371350
MIRT036440	hsa-miR-1226-3p	CLASH	23622248
MIRT471073	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT471072	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT471071	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT471070	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT471069	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT471068	hsa-miR-940	PAR-CLIP	23592263
MIRT471067	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT471065	hsa-miR-4514	PAR-CLIP	23592263
MIRT471066	hsa-miR-4692	PAR-CLIP	23592263
MIRT471064	hsa-miR-4645-5p	PAR-CLIP	23592263
MIRT471063	hsa-miR-4673	PAR-CLIP	23592263
MIRT471062	hsa-miR-1253	PAR-CLIP	23592263
MIRT471061	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT471060	hsa-miR-8064	PAR-CLIP	23592263
MIRT471059	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT471058	hsa-miR-4434	PAR-CLIP	23592263
MIRT471056	hsa-miR-4516	PAR-CLIP	23592263
MIRT471057	hsa-miR-5703	PAR-CLIP	23592263
MIRT471073	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT471072	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT471071	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT471070	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT471069	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT471068	hsa-miR-940	PAR-CLIP	23592263
MIRT471067	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT471065	hsa-miR-4514	PAR-CLIP	23592263
MIRT471066	hsa-miR-4692	PAR-CLIP	23592263
MIRT471064	hsa-miR-4645-5p	PAR-CLIP	23592263
MIRT471063	hsa-miR-4673	PAR-CLIP	23592263
MIRT471062	hsa-miR-1253	PAR-CLIP	23592263
MIRT471061	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT471060	hsa-miR-8064	PAR-CLIP	23592263
MIRT471059	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT471058	hsa-miR-4434	PAR-CLIP	23592263
MIRT471056	hsa-miR-4516	PAR-CLIP	23592263
MIRT471057	hsa-miR-5703	PAR-CLIP	23592263
MIRT1235168	hsa-miR-1182	CLIP-seq
MIRT1235169	hsa-miR-1226	CLIP-seq
MIRT1235170	hsa-miR-1243	CLIP-seq
MIRT1235171	hsa-miR-1292	CLIP-seq
MIRT1235172	hsa-miR-188-5p	CLIP-seq
MIRT1235173	hsa-miR-197	CLIP-seq
MIRT1235174	hsa-miR-200b	CLIP-seq
MIRT1235175	hsa-miR-200c	CLIP-seq
MIRT1235176	hsa-miR-2276	CLIP-seq
MIRT1235177	hsa-miR-24	CLIP-seq
MIRT1235178	hsa-miR-3614-5p	CLIP-seq
MIRT1235179	hsa-miR-3654	CLIP-seq
MIRT1235180	hsa-miR-3664-3p	CLIP-seq
MIRT1235181	hsa-miR-378	CLIP-seq
MIRT1235182	hsa-miR-378b	CLIP-seq
MIRT1235183	hsa-miR-378c	CLIP-seq
MIRT1235184	hsa-miR-378d	CLIP-seq
MIRT1235185	hsa-miR-378e	CLIP-seq
MIRT1235186	hsa-miR-378f	CLIP-seq
MIRT1235187	hsa-miR-378h	CLIP-seq
MIRT1235188	hsa-miR-378i	CLIP-seq
MIRT1235189	hsa-miR-412	CLIP-seq
MIRT1235190	hsa-miR-422a	CLIP-seq
MIRT1235191	hsa-miR-4283	CLIP-seq
MIRT1235192	hsa-miR-429	CLIP-seq
MIRT1235193	hsa-miR-4433	CLIP-seq
MIRT1235194	hsa-miR-4437	CLIP-seq
MIRT1235195	hsa-miR-4449	CLIP-seq
MIRT1235196	hsa-miR-4459	CLIP-seq
MIRT1235197	hsa-miR-4471	CLIP-seq
MIRT1235198	hsa-miR-4490	CLIP-seq
MIRT1235199	hsa-miR-4508	CLIP-seq
MIRT1235200	hsa-miR-450b-3p	CLIP-seq
MIRT1235201	hsa-miR-4520a-3p	CLIP-seq
MIRT1235202	hsa-miR-4520b-3p	CLIP-seq
MIRT1235203	hsa-miR-4532	CLIP-seq
MIRT1235204	hsa-miR-4684-3p	CLIP-seq
MIRT1235205	hsa-miR-4696	CLIP-seq
MIRT1235206	hsa-miR-4724-3p	CLIP-seq
MIRT1235207	hsa-miR-4733-3p	CLIP-seq
MIRT1235208	hsa-miR-4772-3p	CLIP-seq
MIRT1235209	hsa-miR-4797-5p	CLIP-seq
MIRT1235210	hsa-miR-765	CLIP-seq
MIRT1235211	hsa-miR-769-3p	CLIP-seq
MIRT2069234	hsa-miR-3065-5p	CLIP-seq
MIRT2069235	hsa-miR-3121-5p	CLIP-seq
MIRT2069236	hsa-miR-3159	CLIP-seq
MIRT2069237	hsa-miR-3192	CLIP-seq
MIRT2069238	hsa-miR-3674	CLIP-seq
MIRT2069239	hsa-miR-3689a-3p	CLIP-seq
MIRT2069240	hsa-miR-3689c	CLIP-seq
MIRT2069241	hsa-miR-4314	CLIP-seq
MIRT2069242	hsa-miR-4448	CLIP-seq
MIRT2069243	hsa-miR-4476	CLIP-seq
MIRT2069244	hsa-miR-4646-5p	CLIP-seq
MIRT2069245	hsa-miR-4728-5p	CLIP-seq
MIRT2069246	hsa-miR-505	CLIP-seq
MIRT2069247	hsa-miR-654-3p	CLIP-seq
MIRT1235170	hsa-miR-1243	CLIP-seq
MIRT1235171	hsa-miR-1292	CLIP-seq
MIRT2296314	hsa-miR-1343	CLIP-seq
MIRT2296315	hsa-miR-140-3p	CLIP-seq
MIRT2296316	hsa-miR-1587	CLIP-seq
MIRT2296317	hsa-miR-1827	CLIP-seq
MIRT1235172	hsa-miR-188-5p	CLIP-seq
MIRT1235173	hsa-miR-197	CLIP-seq
MIRT1235174	hsa-miR-200b	CLIP-seq
MIRT1235175	hsa-miR-200c	CLIP-seq
MIRT1235177	hsa-miR-24	CLIP-seq
MIRT2069235	hsa-miR-3121-5p	CLIP-seq
MIRT2069236	hsa-miR-3159	CLIP-seq
MIRT2069237	hsa-miR-3192	CLIP-seq
MIRT1235178	hsa-miR-3614-5p	CLIP-seq
MIRT1235179	hsa-miR-3654	CLIP-seq
MIRT2069238	hsa-miR-3674	CLIP-seq
MIRT2069239	hsa-miR-3689a-3p	CLIP-seq
MIRT2069240	hsa-miR-3689c	CLIP-seq
MIRT1235181	hsa-miR-378	CLIP-seq
MIRT1235182	hsa-miR-378b	CLIP-seq
MIRT1235183	hsa-miR-378c	CLIP-seq
MIRT1235184	hsa-miR-378d	CLIP-seq
MIRT1235185	hsa-miR-378e	CLIP-seq
MIRT1235186	hsa-miR-378f	CLIP-seq
MIRT2296318	hsa-miR-378g	CLIP-seq
MIRT1235187	hsa-miR-378h	CLIP-seq
MIRT1235188	hsa-miR-378i	CLIP-seq
MIRT1235189	hsa-miR-412	CLIP-seq
MIRT1235190	hsa-miR-422a	CLIP-seq
MIRT1235192	hsa-miR-429	CLIP-seq
MIRT2069241	hsa-miR-4314	CLIP-seq
MIRT2069242	hsa-miR-4448	CLIP-seq
MIRT1235197	hsa-miR-4471	CLIP-seq
MIRT2069243	hsa-miR-4476	CLIP-seq
MIRT1235198	hsa-miR-4490	CLIP-seq
MIRT2296319	hsa-miR-4492	CLIP-seq
MIRT2296320	hsa-miR-4498	CLIP-seq
MIRT2069244	hsa-miR-4646-5p	CLIP-seq
MIRT2296321	hsa-miR-4649-3p	CLIP-seq
MIRT2296322	hsa-miR-4656	CLIP-seq
MIRT2296323	hsa-miR-4675	CLIP-seq
MIRT1235206	hsa-miR-4724-3p	CLIP-seq
MIRT2069245	hsa-miR-4728-5p	CLIP-seq
MIRT2296324	hsa-miR-4736	CLIP-seq
MIRT2296325	hsa-miR-4741	CLIP-seq
MIRT2296326	hsa-miR-646	CLIP-seq
MIRT2296327	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	20307683
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	18593906
GO:0005515	Function	Protein binding	IPI	16713569, 25416956, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0006468	Process	Protein phosphorylation	IDA	18593906
GO:0006468	Process	Protein phosphorylation	ISS
GO:0006915	Process	Apoptotic process	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IBA	21873635
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	20307683
GO:0009615	Process	Response to virus	IEP	16548883
GO:0010508	Process	Positive regulation of autophagy	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IBA	21873635
GO:0043066	Process	Negative regulation of apoptotic process	IDA	18675992
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	ISS
GO:0045893	Process	Positive regulation of transcription, DNA-templated	ISS
GO:0046777	Process	Protein autophosphorylation	IBA	21873635
GO:0050821	Process	Protein stabilization	IMP	20307683
GO:0050821	Process	Protein stabilization	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA

Other IDs

• MIM: 300295
• HGNC: 8987
• e!Ensembl: ENSG00000102096

Protein

• UniProt ID: Q9P1W9
• Protein name: Serine/threonine-protein kinase pim-2 (EC 2.7.11.1) (Pim-2h)
• Protein function: Proto-oncogene with serine/threonine kinase activity involved in cell survival and cell proliferation. Exerts its oncogenic activity through: the regulation of MYC transcriptional activity, the regulation of cell cycle progression, the regulatio
• PDB: 2IWI, 4X7Q
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	32 → 286	Protein kinase domain	Domain

• Sequence:

  MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
  KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
  PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
  IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
  DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
  GPAPLAWSLLP

• Sequence length: 311