PIK3R6 (phosphoinositide-3-kinase regulatory subunit 6)

Gene

• Entrez ID: 146850
• Gene name: Phosphoinositide-3-kinase regulatory subunit 6
• Gene symbol: PIK3R6
• Synonyms: C17orf38, HsT41028, p84 PIKAP, p87(PIKAP), p87PIKAP
• Chromosome: 17
• Chromosome location: 17p13.1
• Summary: Phosphoinositide 3-kinase gamma is a lipid kinase that produces the lipid second messenger phosphatidylinositol 3,4,5-trisphosphate. The kinase is composed of a catalytic subunit and one of several regulatory subunits, and is chiefly activated by G protein-coupled receptors. This gene encodes a regulatory subunit, and is distantly related to the phosphoinositide-3-kinase, regulatory subunit 5 gene which is located adjacent to this gene on chromosome 7. The orthologous protein in the mouse binds to both the catalytic subunit and to G(beta/gamma), and mediates activation of the kinase subunit downstream of G protein-coupled receptors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0005515	Function	Protein binding	IPI	21393242
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005942	Component	Phosphatidylinositol 3-kinase complex	IBA	21873635
GO:0005944	Component	Phosphatidylinositol 3-kinase complex, class IB	ISS
GO:0006661	Process	Phosphatidylinositol biosynthetic process	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	ISS
GO:0016020	Component	Membrane	ISS
GO:0030168	Process	Platelet activation	TAS
GO:0042269	Process	Regulation of natural killer cell mediated cytotoxicity	IDA	11062502
GO:0043406	Process	Positive regulation of MAP kinase activity	IBA	21873635
GO:0043406	Process	Positive regulation of MAP kinase activity	ISS
GO:0043551	Process	Regulation of phosphatidylinositol 3-kinase activity	IEA
GO:0045582	Process	Positive regulation of T cell differentiation	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IMP	21393242
GO:0046854	Process	Phosphatidylinositol phosphorylation	IEA
GO:0046934	Function	Phosphatidylinositol-4,5-bisphosphate 3-kinase activity	ISS
GO:0046935	Function	1-phosphatidylinositol-3-kinase regulator activity	IBA	21873635
GO:0046935	Function	1-phosphatidylinositol-3-kinase regulator activity	ISS

Other IDs

• MIM: 611462
• HGNC: 27101
• e!Ensembl: ENSG00000276231

Protein

• UniProt ID: Q5UE93
• Protein name: Phosphoinositide 3-kinase regulatory subunit 6 (Phosphoinositide 3-kinase gamma adapter protein of 87 kDa) (p84 PI3K adapter protein) (p84 PIKAP) (p87 PI3K adapter protein) (p87PIKAP)
• Protein function: Regulatory subunit of the PI3K gamma complex. Acts as an adapter to drive activation of PIK3CG by beta-gamma G protein dimers. The PIK3CG:PIK3R6 heterodimer is much less sensitive to beta-gamma G protein dimers than PIK3CG:PIK3R5 and its membrane recruitment and beta-gamma G protein dimer-dependent activation requires HRAS bound to PIK3CG. Recruits of the PI3K gamma complex to a PDE3B:RAPGEF3 signaling complex involved in angiogenesis; signaling seems to involve RRAS.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10486	PI3K_1B_p101	6 → 300	Phosphoinositide 3-kinase gamma adapter protein p101 subunit	Family
  PF10486	PI3K_1B_p101	395 → 474	Phosphoinositide 3-kinase gamma adapter protein p101 subunit	Family
  PF10486	PI3K_1B_p101	468 → 753	Phosphoinositide 3-kinase gamma adapter protein p101 subunit	Family

• Sequence:

  MESSDVELDLQRSVQAVLRELSTQAPALQSNQGMWRWSLHKKVERDPGKSPVLVRILLRE
  LEKAESQDLRHVIIPLLHTVMYVLTKATGITEELYQRIYAFCTRLLTLPTPYCTVALDCA
  IRLKTEMAVPGTLYQRMVIAEQNLTNELYPYQERVFLFVDPELVSASVCSALLLEIEAAQ
  AQQTPETCMRHVVSHALQAALGEACHAGALHRKLQASPRRTLEHYFHAVVAALEQMASEA
  SPSREGHVERLEEIYCSLLGPAAGRCGGDLVQERPPSIPLPSPYITFHLWTGEEQLWKEL
  VLFLRPRSQLRLSADLEVLDLQGLRPDRELARVSVLSTDSGIERDLPTGADELPAPGSPE
  MERAGLQRKGGIKKRAWPLDFLMPGSWDGPPGLHRRTGRPSGDGEMLPGVSRLHTARVLV
  LGDDRMLGRLAQAYHRLRKRETQKFCLTPRLSLQLYYIPVLAPEKPAASRQPELGELATF
  LGRVDPWYQSNVNTLCPAIHKLAEMPPSLDTSRTVDPFILDVITYYIRMGTQPIYFQIYT
  VKIFFSDLSQDPTEDIFLIELKVKIQDSKFPKDGFSPRRRGVAEGPGAELSLCYQKALLS
  HRPREVTVSLRATGLILKAIPASDTEVSGSSHCPLPAAPVTDHTCLNVNVTEVVKSSNLA
  GKSFSTVTNTFRTNNIQIQSRDQRLLTLSLDKDDQRTFRDVVRFEVAPCPEPCSGAQKSK
  APWLNLHGQQEVEAIKAKPKPLLMPINTFSGIVQ

• Sequence length: 754