NPY (neuropeptide Y)

Gene

• Entrez ID: 4852
• Gene name: Neuropeptide Y
• Gene symbol: NPY
• Synonyms: PYY4
• Chromosome: 7
• Chromosome location: 7p15.3
• Summary: This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi. [provided by RefSeq, Oct 2014]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016709	hsa-miR-335-5p	Microarray	18185580

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Unknown	12967770
FOS	Unknown	8036020
JUN	Unknown	8036020
SP1	Unknown	2376581

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IBA	21873635
GO:0004930	Function	G protein-coupled receptor activity	TAS	1321422
GO:0005102	Function	Signaling receptor binding	TAS	8132547, 10698177
GO:0005179	Function	Hormone activity	IBA	21873635
GO:0005184	Function	Neuropeptide hormone activity	IBA	21873635
GO:0005246	Function	Calcium channel regulator activity	TAS	8132547
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	ISS
GO:0005794	Component	Golgi apparatus	IDA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	8132547
GO:0007218	Process	Neuropeptide signaling pathway	IBA	21873635
GO:0007268	Process	Chemical synaptic transmission	TAS	10557353
GO:0007631	Process	Feeding behavior	IBA	21873635
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008343	Process	Adult feeding behavior	ISS
GO:0021954	Process	Central nervous system neuron development	IEP	20846339
GO:0021987	Process	Cerebral cortex development	IEP	9067840
GO:0031175	Process	Neuron projection development	IEP	20846339
GO:0031841	Function	Neuropeptide Y receptor binding	IBA	21873635
GO:0032100	Process	Positive regulation of appetite	ISS
GO:0045202	Component	Synapse	IEA
GO:0060575	Process	Intestinal epithelial cell differentiation	TAS	10488139
GO:0098992	Component	Neuronal dense core vesicle	ISS

Other IDs

• MIM: 162640
• HGNC: 7955
• e!Ensembl: ENSG00000122585

Protein

• UniProt ID: P01303
• Protein name: Pro-neuropeptide Y [Cleaved into: Neuropeptide Y (Neuropeptide tyrosine) (NPY); C-flanking peptide of NPY (CPON)]
• Protein function: NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
• PDB: 1QFA, 1RON
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00159	Hormone_3	30 → 64	Pancreatic hormone peptide	Family

• Sequence:

  MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT
  RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW

• Sequence length: 97