GediPNet logo

NPPA (natriuretic peptide A)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4878
Gene nameGene Name - the full gene name approved by the HGNC.
Natriuretic peptide A
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
NPPA
SynonymsGene synonyms aliases
ANF, ANP, ATFB6, ATRST2, CDD, CDD-ANF, CDP, PND
ChromosomeChromosome number
1
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.22
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. Mutations in this gene have been associated with atrial fibrillation familial type 6. This gene is located adjacent to another member of the natriuretic family of peptides on chromosome 1. [provided by RefSeq, Oct 2015]
Transcription factors
Transcription factor Regulation Reference
ANKRD1 Repression 18273862
FOS Unknown 1530876
GATA4 Activation 14573514
HAND2 Activation 12392994
JARID2 Unknown 18805276
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003085 Process Negative regulation of systemic arterial blood pressure IBA 21873635
GO:0003180 Process Aortic valve morphogenesis TAS 29325903
GO:0005102 Function Signaling receptor binding IDA 1672777
GO:0005102 Function Signaling receptor binding IPI 16870210
GO:0005179 Function Hormone activity IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P01160
Protein name Natriuretic peptides A (Atrial natriuretic factor prohormone) (proANF) (Atrial natriuretic peptide prohormone) (preproANP) (proANP) (Atriopeptigen) (Cardiodilatin) (CDD) (preproCDD-ANF) [Cleaved into: Long-acting natriuretic peptide (LANP) (Long-acting natriuretic hormone) (LANH) (Pro atrial natriuretic factor 1-30) (proANF 1-30) (Pro atrial natriuretic peptide 1-30) (proANP 1-30); Vessel dilator (VSDL) (Pro atrial natriuretic factor 31-67) (proANF 31-67) (Pro atrial natriuretic peptide 31-67) (proANP 31-67); Kaliuretic peptide (KP) (Pro atrial natriuretic factor 79-98) (proANF 79-98) (Pro atrial natriuretic peptide 79-98) (proANP 79-98); Urodilatin (URO) (CDD 95-126) (CDD-ANP (95-126)) (Pro atrial natriuretic peptide 95-126) (proANP 95-126); Auriculin-C (Atrial natriuretic factor 1-33) (ANF 1-33); Auriculin-D (Atrial natriuretic factor 3-33) (ANF 3-33); Atrial natriuretic peptide (ANP) (Alpha-atrial natriuretic peptide) (Alpha-hANP) (Atrial natriuretic factor) (ANF) (CDD-ANF) (CDD-ANP (99-126)) (Cardionatrin) (Pro atrial natriuretic factor 99-126) (proANF 99-126); Auriculin-B (Atrial natriuretic factor 8-33) (ANF 8-33); Auriculin-A; Atriopeptin-1 (Atriopeptin I); Atriopeptin-2 (Atriopeptin II); Atriopeptin-3 (Atriopeptin III)]
Protein function [Atrial natriuretic peptide]: Hormone that plays a key role in mediating cardio-renal homeostasis, and is involved in vascular remodeling and regulating energy metabolism (PubMed:8653797, PubMed:7595132, PubMed:2825692, PubMed:7720651, PubMed:8087923, PubMed:2532366, PubMed:22307324, PubMed:18835931, PubMed:21672517, PubMed:15741263, PubMed:16875975). Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn activates effector proteins, such as PRKG1, that drive various biological responses (PubMed:25401746, PubMed:9893117, PubMed:1672777, PubMed:1660465, PubMed:2162527, PubMed:2825692, PubMed:7720651, PubMed:22307324, PubMed:8384600, PubMed:21098034). Regulates vasodilation, natriuresis, diuresis and aldosterone synthesis and is therefore essential for regulating blood pressure, controlling the extracellular fluid volume and maintaining the fluid-electrolyte balance (PubMed:8653797, PubMed:7595132, PubMed:2825692, PubMed:7720651, PubMed:2532366, PubMed:8087923). Also involved in inhibiting cardiac remodeling and cardiac hypertrophy by inducing cardiomyocyte apoptosis and attenuating the growth of cardiomyocytes and fibroblasts (PubMed:16875975). Plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus, and thus prevents pregnancy-induced hypertension (By similarity). In adipose tissue, acts in various cGMP- and PKG-dependent pathways to regulate lipid metabolism and energy homeostasis (PubMed:22307324, PubMed:18835931, PubMed:21672517, PubMed:15741263). This includes upregulating lipid metabolism and mitochondrial oxygen utilization by activating the AMP-activated protein kinase (AMPK), and increasing energy expenditure by acting via MAPK11 to promote the UCP1-dependent thermogenesis of brown adipose tissue (PubMed:22307324, PubMed:18835931, PubMed:21672517, PubMed:15741263). Binds the clearance receptor NPR3 which removes the hormone from circulation (PubMed:1672777). ; [Long-acting natriuretic peptide]: May have a role in cardio-renal homeostasis through regulation of natriuresis, diuresis, vasodilation, and inhibiting aldosterone synthesis (PubMed:8653797, PubMed:7955907, PubMed:8087923, PubMed:2825692, PubMed:7595132, PubMed:2532366). In vitro, promotes the production of cGMP and induces vasodilation (PubMed:2825692). May promote natriuresis, at least in part, by enhancing prostaglandin E2 synthesis resulting in the inhibition of renal Na+-K+-ATPase (PubMed:7720651). However reports on the involvement of this peptide in mammal blood volume and blood pressure homeostasis are conflicting; according to a report, in vivo it is not sufficient to activate cGMP and does not inhibit collecting duct transport nor effect diuresis and natriuresis (By similarity). Appears to bind to specific receptors that are distinct from the receptors bound by atrial natriuretic peptide and vessel dilator (PubMed:2162527, PubMed:2825692). Possibly enhances protein excretion in urine by decreasing proximal tubular protein reabsorption (PubMed:11145122). ; [Vessel dilator]: May have a role in cardio-renal homeostasis through regulation of natriuresis, diuresis, and vasodilation (PubMed:8653797, PubMed:7955907, PubMed:8087923, PubMed:2532366, PubMed:7595132). In vitro, promotes the production of cGMP and induces vasodilation (PubMed:2825692). May promote natriuresis, at least in part, by enhancing prostaglandin E2 synthesis resulting in the inhibition of renal Na+-K+-ATPase (PubMed:7720651, PubMed:7595132). However reports on the involvement of this peptide in mammal blood volume and blood pressure homeostasis are conflicting; according to a report it is not sufficient to activate cGMP and does not inhibit collecting duct transport nor effect diuresis and natriuresis (PubMed:7831500). Appears to bind to specific receptors that are distinct from the receptors bound by the atrial natriuretic and long-acting natriuretic peptides (PubMed:2162527, PubMed:2825692). Possibly functions in protein excretion in urine by maintaining the integrity of the proximal tubules and enhancing protein excretion by decreasing proximal tubular protein reabsorption (PubMed:11145122). ; [Kaliuretic peptide]: May have a role in cardio-renal homeostasis through regulation of diuresis and inhibiting aldosterone synthesis (PubMed:8087923, PubMed:2825692, PubMed:7595132). In vitro, promotes the production of cGMP and induces vasodilation (PubMed:2825692). May promote natriuresis, at least in part, by enhancing prostaglandin E2 synthesis resulting in the inhibition of renal Na+-K+-ATPase (PubMed:7720651, PubMed:7595132). May have a role in potassium excretion but not sodium excretion (natriuresis) (PubMed:8087923). Possibly enhances protein excretion in urine by decreasing proximal tubular protein reabsorption (PubMed:11145122). ; [Urodilatin]: Hormone produced in the kidneys that appears to be important for maintaining cardio-renal homeostasis (PubMed:8351194, PubMed:8853410, PubMed:8779891). Mediates vasodilation, natriuresis and diuresis primarily in the renal system, in order to maintain the extracellular fluid volume and control the fluid-electrolyte balance (PubMed:2528951, PubMed:8351194, PubMed:8853410, PubMed:8779891). Specifically binds and stimulates cGMP production by renal transmembrane receptors, likely NPR1 (PubMed:8384600, PubMed:9893117). Urodilatin not ANP, may be the natriuretic peptide responsible for the regulation of sodium and water homeostasis in the kidney (PubMed:8779891, PubMed:8384600). ; [Auriculin-D]: May have a role in cardio-renal homeostasis through regulation of natriuresis and vasodilation. In vivo promotes natriuresis and in vitro, vasodilates renal artery strips. ; [Auriculin-B]: May have a role in cardio-renal homeostasis through regulation of natriuresis and vasodilation. In vivo promotes natriuresis and in vitro, vasodilates renal artery strips. ; [Auriculin-A]: May have a role in cardio-renal homeostasis through regulation of regulation of natriuresis and vasodilation. In vivo promotes natriuresis. In vitro, vasodilates intestinal smooth muscle but not smooth muscle strips. ; [Atriopeptin-2]: May have a role in cardio-renal homeostasis through regulation of natriuresis and vasodilation. In vivo promotes natriuresis. In vitro, selectively vasodilates intestinal and vascular smooth muscle strips. ; [Atriopeptin-1]: May have a role in cardio-renal homeostasis through regulation of natriuresis and vasodilation. In vivo promotes natriuresis. In vitro, selectively vasodilates intestinal smooth muscle but not vascular smooth muscle strips.
PDB 1ANP , 1YK0 , 3N57
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00212 ANP
116 146
Atrial natriuretic peptide
Family
Sequence
MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPP
QVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLT
APRSLRRSSCFGGRMDRIGAQSGLGC
NSFRY
Sequence length 151
Interactions View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412