NPPA (natriuretic peptide A)

Gene

• Entrez ID: 4878
• Gene name: Natriuretic peptide A
• Gene symbol: NPPA
• Synonyms: ANF, ANP, ATFB6, ATRST2, CDD, CDD-ANF, CDP, PND
• Chromosome: 1
• Chromosome location: 1p36.22
• Summary: The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal

Transcription factors

Transcription factor	Regulation	Reference
ANKRD1	Repression	18273862
FOS	Unknown	1530876
GATA4	Activation	14573514
HAND2	Activation	12392994
JARID2	Unknown	18805276
NKX2-2	Activation	14573514
TBX5	Activation	14573514;18451335
ZIC3	Unknown	17468179

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003085	Process	Negative regulation of systemic arterial blood pressure	IBA	21873635
GO:0003180	Process	Aortic valve morphogenesis	TAS	29325903
GO:0005102	Function	Signaling receptor binding	IDA	1672777
GO:0005102	Function	Signaling receptor binding	IPI	16870210
GO:0005179	Function	Hormone activity	IBA	21873635
GO:0005184	Function	Neuropeptide hormone activity	IMP	19646991
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0006182	Process	CGMP biosynthetic process	IBA	21873635
GO:0006182	Process	CGMP biosynthetic process	IDA	1672777
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	TAS
GO:0006457	Process	Protein folding	IDA	16870210
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IBA	21873635
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IDA	1672777
GO:0007218	Process	Neuropeptide signaling pathway	IBA	21873635
GO:0007218	Process	Neuropeptide signaling pathway	IDA	19646991
GO:0007565	Process	Female pregnancy	ISS
GO:0008217	Process	Regulation of blood pressure	IDA	6230082, 6547996
GO:0010460	Process	Positive regulation of heart rate	IMP	19646991
GO:0019934	Process	CGMP-mediated signaling	IBA	21873635
GO:0032991	Component	Protein-containing complex	IDA	16870210
GO:0035994	Process	Response to muscle stretch	TAS	15276478
GO:0042311	Process	Vasodilation	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043508	Process	Negative regulation of JUN kinase activity	IDA	22399583
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0051427	Function	Hormone receptor binding	IBA	21873635
GO:0051427	Function	Hormone receptor binding	IPI	1660465
GO:0060372	Process	Regulation of atrial cardiac muscle cell membrane repolarization	IMP	19646991
GO:0060452	Process	Positive regulation of cardiac muscle contraction	IMP	19646991
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	27559042
GO:0071855	Function	Neuropeptide receptor binding	IMP	19646991
GO:1901841	Process	Regulation of high voltage-gated calcium channel activity	ISS	8301666
GO:1902261	Process	Positive regulation of delayed rectifier potassium channel activity	IDA	8301666, 19646991
GO:1902514	Process	Regulation of calcium ion transmembrane transport via high voltage-gated calcium channel	ISS	8301666
GO:1903766	Process	Positive regulation of potassium ion export across plasma membrane	IDA	8301666, 19646991
GO:1903779	Process	Regulation of cardiac conduction	TAS

Other IDs

• MIM: 108780
• HGNC: 7939
• e!Ensembl: ENSG00000175206

Protein

• UniProt ID: P01160
• Protein name: Natriuretic peptides A (Atrial natriuretic factor prohormone) (proANF) (Atrial natriuretic peptide prohormone) (preproANP) (proANP) (Atriopeptigen) (Cardiodilatin) (CDD) (preproCDD-ANF) [Cleaved into: Long-acting natriuretic peptide (LANP) (Long-acting na
• Protein function: [Atrial natriuretic peptide]: Hormone that plays a key role in mediating cardio-renal homeostasis, and is involved in vascular remodeling and regulating energy metabolism (PubMed:15741263, PubMed:16875975, PubMed:18835931, PubMed:21672517, PubMe
• PDB: 1ANP, 1YK0, 3N57, 7BRH, 7BRJ, 7BRK, 8TG9, 9BCQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00212	ANP	116 → 146	Atrial natriuretic peptide	Family

• Sequence:

  MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPP
  QVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLT
  APRSLRRSSCFGGRMDRIGAQSGLGCNSFRY

• Sequence length: 151