NLK (nemo like kinase)

Gene

• Entrez ID: 51701
• Gene name: Nemo like kinase
• Gene symbol: NLK
• Synonyms: -
• Chromosome: 17
• Chromosome location: 17q11.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000233	hsa-miR-181c-5p	Luciferase reporter assay	19585654
MIRT000238	hsa-miR-181b-5p	Luciferase reporter assay	19585654
MIRT000243	hsa-miR-181a-5p	Luciferase reporter assay	19585654
MIRT024563	hsa-miR-215-5p	Microarray	19074876
MIRT026531	hsa-miR-192-5p	Microarray	19074876
MIRT035518	hsa-miR-92b-3p	Luciferase reporter assay	23416699
MIRT035518	hsa-miR-92b-3p	Luciferase reporter assay, Western blot	26503628
MIRT050387	hsa-miR-23a-3p	CLASH	23622248
MIRT054629	hsa-miR-199b-5p	ChIP-seq, Flow, qRT-PCR, Western blot	24608802
MIRT438193	hsa-miR-101-3p	Luciferase reporter assay	24189458
MIRT472135	hsa-miR-3682-5p	PAR-CLIP	23592263
MIRT472136	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT472137	hsa-miR-545-3p	PAR-CLIP	23592263
MIRT472138	hsa-miR-3120-3p	PAR-CLIP	23592263
MIRT472139	hsa-miR-5692a	PAR-CLIP	23592263
MIRT472140	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT472141	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT522254	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT522255	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT522256	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT522257	hsa-miR-3121-3p	PAR-CLIP	23446348
MIRT522258	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT627953	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT627954	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT627955	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT627956	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT627957	hsa-miR-5696	HITS-CLIP	23824327
MIRT627958	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT627959	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT627960	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT627961	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT627962	hsa-miR-1285-5p	HITS-CLIP	23824327
MIRT627963	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT701392	hsa-miR-6802-5p	HITS-CLIP	23313552
MIRT701393	hsa-miR-6800-5p	HITS-CLIP	23313552
MIRT701394	hsa-miR-6822-3p	HITS-CLIP	23313552
MIRT701395	hsa-miR-3622b-5p	HITS-CLIP	23313552
MIRT701396	hsa-miR-6770-5p	HITS-CLIP	23313552
MIRT701397	hsa-miR-1253	HITS-CLIP	23313552
MIRT701398	hsa-miR-6741-3p	HITS-CLIP	23313552
MIRT701399	hsa-miR-135a-3p	HITS-CLIP	23313552
MIRT701400	hsa-miR-6865-5p	HITS-CLIP	23313552
MIRT701401	hsa-miR-6815-5p	HITS-CLIP	23313552
MIRT701402	hsa-miR-3158-3p	HITS-CLIP	23313552
MIRT701403	hsa-miR-4446-3p	HITS-CLIP	23313552
MIRT701404	hsa-miR-5088-5p	HITS-CLIP	23313552
MIRT701405	hsa-miR-944	HITS-CLIP	23313552
MIRT733422	hsa-miR-409-3p	Luciferase reporter assay	26084278

Transcription factors

Transcription factor	Regulation	Reference
FOXO1	Unknown	23144700
STAT3	Unknown	15764709

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0000287	Function	Magnesium ion binding	ISS
GO:0004672	Function	Protein kinase activity	TAS	10863097
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004707	Function	MAP kinase activity	IBA	21873635
GO:0004707	Function	MAP kinase activity	ISS
GO:0005515	Function	Protein binding	IPI	15764709, 16713569, 21454679, 21516116, 21988832, 22773187, 23602568, 25241761, 25416956, 25910212, 31515488, 32296183, 32814053
GO:0005524	Function	ATP binding	ISS
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of transcription, DNA-templated	ISS
GO:0006468	Process	Protein phosphorylation	ISS
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	15004007
GO:0007223	Process	Wnt signaling pathway, calcium modulating pathway	TAS
GO:0008134	Function	Transcription factor binding	IPI	16714285, 25512613
GO:0018107	Process	Peptidyl-threonine phosphorylation	ISS
GO:0030178	Process	Negative regulation of Wnt signaling pathway	ISS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	16714285
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0035556	Process	Intracellular signal transduction	ISS
GO:0042169	Function	SH2 domain binding	ISS
GO:0042501	Process	Serine phosphorylation of STAT protein	ISS
GO:0046777	Process	Protein autophosphorylation	IEA
GO:0050821	Process	Protein stabilization	IDA	25512613

Other IDs

• MIM: 609476
• HGNC: 29858
• e!Ensembl: ENSG00000087095

Protein

• UniProt ID: Q9UBE8
• Protein name: Serine/threonine-protein kinase NLK (EC 2.7.11.24) (Nemo-like kinase) (Protein LAK1)
• Protein function: Serine/threonine-protein kinase that regulates a number of transcription factors with key roles in cell fate determination. Positive effector of the non-canonical Wnt signaling pathway, acting downstream of WNT5A, MAP3K7/TAK1 and HIPK2. Negative regulator of the canonical Wnt/beta-catenin signaling pathway. Binds to and phosphorylates TCF7L2/TCF4 and LEF1, promoting the dissociation of the TCF7L2/LEF1/beta-catenin complex from DNA, as well as the ubiquitination and subsequent proteolysis of LEF1. Together these effects inhibit the transcriptional activation of canonical Wnt/beta-catenin target genes. Negative regulator of the Notch signaling pathway. Binds to and phosphorylates NOTCH1, thereby preventing the formation of a transcriptionally active ternary complex of NOTCH1, RBPJ/RBPSUH and MAML1. Negative regulator of the MYB family of transcription factors. Phosphorylation of MYB leads to its subsequent proteolysis while phosphorylation of MYBL1 and MYBL2 inhibits their interaction with the coactivator CREBBP. Other transcription factors may also be inhibited by direct phosphorylation of CREBBP itself. Acts downstream of IL6 and MAP3K7/TAK1 to phosphorylate STAT3, which is in turn required for activation of NLK by MAP3K7/TAK1. Upon IL1B stimulus, cooperates with ATF5 to activate the transactivation activity of C/EBP subfamily members. Phosphorylates ATF5 but also stabilizes ATF5 protein levels in a kinase-independent manner (PubMed:25512613).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	138 → 427	Protein kinase domain	Domain

• Sequence:

  MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
  VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
  VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
  RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
  VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
  VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
  SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
  ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
  IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE

• Sequence length: 527