NFATC1 (nuclear factor of activated T cells 1)

Gene

• Entrez ID: 4772
• Gene name: Nuclear factor of activated T cells 1
• Gene symbol: NFATC1
• Synonyms: NF-ATC, NF-ATc1.2, NFAT2, NFATc
• Chromosome: 18
• Chromosome location: 18q23
• Summary: The product of this gene is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. Different isoforms of this protein may regulate inducible expression of different cytokine genes. [provided by RefSeq, Jul 2013]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002918	hsa-miR-124-3p	Microarray	18668037
MIRT002918	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	23853098
MIRT052157	hsa-let-7b-5p	CLASH	23622248
MIRT438543	hsa-miR-145-5p	Luciferase reporter assay	24043548
MIRT639061	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT639062	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT639063	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT639064	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT639065	hsa-miR-623	HITS-CLIP	23824327
MIRT639066	hsa-miR-324-5p	HITS-CLIP	23824327
MIRT639067	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT639068	hsa-miR-4671-5p	HITS-CLIP	23824327
MIRT639069	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT731824	hsa-miR-143-3p	Luciferase reporter assay, qRT-PCR, Western blot	27639060

Transcription factors

Transcription factor	Regulation	Reference
LMO2	Activation	22517897

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IDA	15304486
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS
GO:0001085	Function	RNA polymerase II transcription factor binding	ISS
GO:0001225	Function	RNA polymerase II transcription coactivator binding	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0001816	Process	Cytokine production	IBA	21873635
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0003184	Process	Pulmonary valve morphogenesis	ISS
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9506523, 10821850
GO:0005515	Function	Protein binding	IPI	17882263, 18218901, 21880741, 23468591, 24954618, 25609649
GO:0005528	Function	FK506 binding	TAS	8702849
GO:0005634	Component	Nucleus	IDA	12370307
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA	21873635
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007223	Process	Wnt signaling pathway, calcium modulating pathway	TAS
GO:0008134	Function	Transcription factor binding	IBA	21873635
GO:0016604	Component	Nuclear body	IDA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	ISS
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IBA	21873635
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IDA	14979875
GO:0035556	Process	Intracellular signal transduction	IDA	14749367
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	14749367, 14979875
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	14979875
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	14979875
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048273	Function	Mitogen-activated protein kinase p38 binding	ISS
GO:1905064	Process	Negative regulation of vascular associated smooth muscle cell differentiation	IDA	23853098
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 600489
• HGNC: 7775
• e!Ensembl: ENSG00000131196

Protein

• UniProt ID: O95644
• Protein name: Nuclear factor of activated T-cells, cytoplasmic 1 (NF-ATc1) (NFATc1) (NFAT transcription complex cytosolic component) (NF-ATc) (NFATc)
• Protein function: Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 or IL-4 gene transcription. Also controls gene expression in embryonic cardiac cells. Could regulate not only the activation and proliferation but also the differentiation and programmed death of T-lymphocytes as well as lymphoid and non-lymphoid cells (PubMed:10358178). Required for osteoclastogenesis and regulates many genes important for osteoclast differentiation and function (By similarity).
• PDB: 1A66, 1NFA, 5SVE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00554	RHD_DNA_bind	428 → 588	Rel homology DNA-binding domain	Domain
  PF16179	RHD_dimer	597 → 697	Rel homology dimerisation domain	Domain

• Sequence:

  MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPT
  AHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRI
  EITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSR
  SCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPST
  SPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSW
  LGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSP
  PPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLP
  SHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGT
  ADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLR
  NSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEK
  QSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEI
  PPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQ
  GLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGV
  ASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQVSAPPSSSCPPGLEH
  SLCPSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHE
  DGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS

• Sequence length: 943