GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

NFATC1 (nuclear factor of activated T cells 1)

Gene

4772

Nuclear factor of activated T cells 1

NFATC1

NF-ATC, NF-ATc1.2, NFAT2, NFATc

18q23

The product of this gene is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor

Show/Hide all(96)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002918	hsa-miR-124-3p	Microarray	18668037
MIRT052157	hsa-let-7b-5p	CLASH	23622248
MIRT002918	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	23853098
MIRT002918	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	23853098
MIRT002918	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	23853098
MIRT002918	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	23853098
MIRT438543	hsa-miR-145-5p	Luciferase reporter assay	24043548
MIRT438543	hsa-miR-145-5p	Luciferase reporter assay	24043548
MIRT639069	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT639068	hsa-miR-4671-5p	HITS-CLIP	23824327
MIRT639067	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT639066	hsa-miR-324-5p	HITS-CLIP	23824327
MIRT639065	hsa-miR-623	HITS-CLIP	23824327
MIRT639064	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT639063	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT639061	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT639062	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT731824	hsa-miR-143-3p	Luciferase reporter assay, qRT-PCR, Western blot	27639060
MIRT731824	hsa-miR-143-3p	Luciferase reporter assay, qRT-PCR, Western blot	27639060
MIRT639069	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT639068	hsa-miR-4671-5p	HITS-CLIP	23824327
MIRT639067	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT639066	hsa-miR-324-5p	HITS-CLIP	23824327
MIRT639065	hsa-miR-623	HITS-CLIP	23824327
MIRT639064	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT639063	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT639061	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT639062	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT1182128	hsa-miR-1231	CLIP-seq
MIRT1182129	hsa-miR-1305	CLIP-seq
MIRT1182130	hsa-miR-346	CLIP-seq
MIRT1182131	hsa-miR-34b	CLIP-seq
MIRT1182132	hsa-miR-3913-3p	CLIP-seq
MIRT1182133	hsa-miR-4263	CLIP-seq
MIRT1182134	hsa-miR-4288	CLIP-seq
MIRT1182135	hsa-miR-4310	CLIP-seq
MIRT1182136	hsa-miR-4699-3p	CLIP-seq
MIRT1182137	hsa-miR-4705	CLIP-seq
MIRT1182138	hsa-miR-576-5p	CLIP-seq
MIRT1182139	hsa-miR-632	CLIP-seq
MIRT1182140	hsa-miR-642b	CLIP-seq
MIRT1182141	hsa-miR-1260	CLIP-seq
MIRT1182142	hsa-miR-1260b	CLIP-seq
MIRT1182143	hsa-miR-188-3p	CLIP-seq
MIRT1182144	hsa-miR-3156-3p	CLIP-seq
MIRT1182145	hsa-miR-662	CLIP-seq
MIRT2052812	hsa-miR-1203	CLIP-seq
MIRT2052813	hsa-miR-1256	CLIP-seq
MIRT2052814	hsa-miR-1270	CLIP-seq
MIRT1182129	hsa-miR-1305	CLIP-seq
MIRT2052815	hsa-miR-1343	CLIP-seq
MIRT2052816	hsa-miR-223	CLIP-seq
MIRT2052817	hsa-miR-3660	CLIP-seq
MIRT2052818	hsa-miR-3665	CLIP-seq
MIRT2052819	hsa-miR-3689d	CLIP-seq
MIRT1182132	hsa-miR-3913-3p	CLIP-seq
MIRT2052820	hsa-miR-409-3p	CLIP-seq
MIRT2052821	hsa-miR-4290	CLIP-seq
MIRT2052822	hsa-miR-4443	CLIP-seq
MIRT2052823	hsa-miR-4526	CLIP-seq
MIRT2052824	hsa-miR-4531	CLIP-seq
MIRT2052825	hsa-miR-4645-3p	CLIP-seq
MIRT2052826	hsa-miR-4667-3p	CLIP-seq
MIRT2052827	hsa-miR-4687-5p	CLIP-seq
MIRT2052828	hsa-miR-4704-3p	CLIP-seq
MIRT2052829	hsa-miR-4720-5p	CLIP-seq
MIRT2052830	hsa-miR-4765	CLIP-seq
MIRT2052831	hsa-miR-4781-3p	CLIP-seq
MIRT2052832	hsa-miR-4799-3p	CLIP-seq
MIRT2052833	hsa-miR-620	CLIP-seq
MIRT2052834	hsa-miR-628-5p	CLIP-seq
MIRT1182140	hsa-miR-642b	CLIP-seq
MIRT2052835	hsa-miR-671-5p	CLIP-seq
MIRT1182128	hsa-miR-1231	CLIP-seq
MIRT2282031	hsa-miR-124	CLIP-seq
MIRT2052814	hsa-miR-1270	CLIP-seq
MIRT1182130	hsa-miR-346	CLIP-seq
MIRT2282032	hsa-miR-3545-3p	CLIP-seq
MIRT2282033	hsa-miR-3714	CLIP-seq
MIRT2282034	hsa-miR-3910	CLIP-seq
MIRT2052820	hsa-miR-409-3p	CLIP-seq
MIRT1182134	hsa-miR-4288	CLIP-seq
MIRT1182135	hsa-miR-4310	CLIP-seq
MIRT2052824	hsa-miR-4531	CLIP-seq
MIRT2282035	hsa-miR-4539	CLIP-seq
MIRT2282036	hsa-miR-4652-3p	CLIP-seq
MIRT2282037	hsa-miR-4712-5p	CLIP-seq
MIRT2052831	hsa-miR-4781-3p	CLIP-seq
MIRT2282038	hsa-miR-506	CLIP-seq
MIRT2282039	hsa-miR-617	CLIP-seq
MIRT2052833	hsa-miR-620	CLIP-seq
MIRT1182139	hsa-miR-632	CLIP-seq
MIRT2282040	hsa-miR-770-5p	CLIP-seq
MIRT2455090	hsa-miR-3200-5p	CLIP-seq
MIRT2455091	hsa-miR-4682	CLIP-seq
MIRT2455092	hsa-miR-496	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
LMO2	Activation	22517897

Show/Hide all(38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IDA	15304486
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS
GO:0001085	Function	RNA polymerase II transcription factor binding	ISS
GO:0001225	Function	RNA polymerase II transcription coactivator binding	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0001816	Process	Cytokine production	IBA	21873635
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0003184	Process	Pulmonary valve morphogenesis	ISS
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9506523, 10821850
GO:0005515	Function	Protein binding	IPI	17882263, 18218901, 21880741, 23468591, 24954618, 25609649
GO:0005528	Function	FK506 binding	TAS	8702849
GO:0005634	Component	Nucleus	IDA	12370307
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA	21873635
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007223	Process	Wnt signaling pathway, calcium modulating pathway	TAS
GO:0008134	Function	Transcription factor binding	IBA	21873635
GO:0016604	Component	Nuclear body	IDA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	ISS
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IBA	21873635
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IDA	14979875
GO:0035556	Process	Intracellular signal transduction	IDA	14749367
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	14749367, 14979875
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	14979875
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	14979875
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048273	Function	Mitogen-activated protein kinase p38 binding	ISS
GO:1905064	Process	Negative regulation of vascular associated smooth muscle cell differentiation	IDA	23853098
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
600489	7775	ENSG00000131196

Protein

UniProt ID

O95644

Protein name

Nuclear factor of activated T-cells, cytoplasmic 1 (NF-ATc1) (NFATc1) (NFAT transcription complex cytosolic component) (NF-ATc) (NFATc)

Protein function

Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 or IL-4 gene transcription. Also controls gene expression in embryonic cardiac cells. Could regulate not only the activation and proli

PDB

1A66 , 1NFA , 5SVE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00554	RHD_DNA_bind	428 → 588	Rel homology DNA-binding domain	Domain
PF16179	RHD_dimer	597 → 697	Rel homology dimerisation domain	Domain

Sequence

MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPT
AHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRI
EITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSR
SCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPST
SPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSW
LGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSP
PPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLP
SHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGT
ADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLR
NSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEK
QSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEI
PPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQ
GLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGV
ASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQVSAPPSSSCPPGLEH
SLCPSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHE
DGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS

Sequence length

943

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412