NECTIN2 (nectin cell adhesion molecule 2)

Gene

• Entrez ID: 5819
• Gene name: Nectin cell adhesion molecule 2
• Gene symbol: NECTIN2
• Synonyms: CD112, HVEB, PRR2, PVRL2, PVRR2
• Chromosome: 19
• Chromosome location: 19q13.32
• Summary: This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT439851	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439851	hsa-miR-218-5p	HITS-CLIP	23212916

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0001675	Process	Acrosome assembly	IBA	21873635
GO:0002860	Process	Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IBA	21873635
GO:0002860	Process	Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IMP	12913096
GO:0002891	Process	Positive regulation of immunoglobulin mediated immune response	IBA	21873635
GO:0002891	Process	Positive regulation of immunoglobulin mediated immune response	IMP	16831868
GO:0005515	Function	Protein binding	IPI	16189514, 19011627, 21982860, 22902367, 23750010, 23758976, 25416956, 26755705, 27978489, 28515320, 29997244
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IDA	9845526
GO:0005915	Component	Zonula adherens	ISS	10225955
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007010	Process	Cytoskeleton organization	IBA	21873635
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IBA	21873635
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IDA	9845526
GO:0007286	Process	Spermatid development	ISS
GO:0007289	Process	Spermatid nucleus differentiation	IEA
GO:0009566	Process	Fertilization	IEA
GO:0009986	Component	Cell surface	IDA	16831868
GO:0015026	Function	Coreceptor activity	TAS	9657005
GO:0016021	Component	Integral component of membrane	IBA	21873635
GO:0016021	Component	Integral component of membrane	IDA	12913096
GO:0019064	Process	Fusion of virus membrane with host plasma membrane	IBA	21873635
GO:0019064	Process	Fusion of virus membrane with host plasma membrane	IDA	12915581
GO:0030382	Process	Sperm mitochondrion organization	IEA
GO:0032990	Process	Cell part morphogenesis	IEA
GO:0033005	Process	Positive regulation of mast cell activation	IBA	21873635
GO:0033005	Process	Positive regulation of mast cell activation	IMP	16831868
GO:0034332	Process	Adherens junction organization	TAS
GO:0042271	Process	Susceptibility to natural killer cell mediated cytotoxicity	IBA	21873635
GO:0042271	Process	Susceptibility to natural killer cell mediated cytotoxicity	IMP	12913096
GO:0042802	Function	Identical protein binding	IPI	21982860, 22902367, 22927415, 23758976, 28515320
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0043296	Component	Apical junction complex	IBA	21873635
GO:0044291	Component	Cell-cell contact zone	IEA
GO:0044406	Process	Adhesion of symbiont to host	IDA	12915581
GO:0044782	Process	Cilium organization	IEA
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IMP	16304049
GO:0046596	Process	Regulation of viral entry into host cell	IBA	21873635
GO:0046596	Process	Regulation of viral entry into host cell	IDA	11602758
GO:0046814	Process	Coreceptor-mediated virion attachment to host cell	IBA	21873635
GO:0046814	Process	Coreceptor-mediated virion attachment to host cell	IDA	12915581
GO:0050776	Process	Regulation of immune response	TAS
GO:0050839	Function	Cell adhesion molecule binding	IBA	21873635
GO:0050839	Function	Cell adhesion molecule binding	IPI	9845526, 12913096
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	IBA	21873635
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	IDA	26755705
GO:0051654	Process	Establishment of mitochondrion localization	IBA	21873635
GO:0060370	Process	Susceptibility to T cell mediated cytotoxicity	IBA	21873635
GO:0060370	Process	Susceptibility to T cell mediated cytotoxicity	IDA	15039383
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 600798
• HGNC: 9707
• e!Ensembl: ENSG00000130202

Protein

• UniProt ID: Q92692
• Protein name: Nectin-2 (Herpes virus entry mediator B) (Herpesvirus entry mediator B) (HveB) (Nectin cell adhesion molecule 2) (Poliovirus receptor-related protein 2) (CD antigen CD112)
• Protein function: Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5,
• PDB: 3R0N, 4DFH, 4DFI, 4HZA, 5V52, 8X6B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	37 → 159	Immunoglobulin V-set domain	Domain
  PF08205	C2-set_2	159 → 249	CD80-like C2-set immunoglobulin domain	Domain

• Sequence:

  MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPV
  PGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAEL
  QDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTV
  ALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKV
  EHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTS
  GTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG
  IIGGIIAAIIATAVAATGILICRQQRKEQTLQGAEEDEDLEGPPSYKPPTPKAKLEAQEM
  PSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPV
  PPGPPAVEDVSLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV

• Sequence length: 538