MYL9 (myosin light chain 9)

Gene

• Entrez ID: 10398
• Gene name: Myosin light chain 9
• Gene symbol: MYL9
• Synonyms: LC20, MLC-2C, MLC2, MMIHS4, MRLC1, MYRL2
• Chromosome: 20
• Chromosome location: 20q11.23
• Summary: Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded protein binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT437478	hsa-miR-663a	Luciferase reporter assay, qRT-PCR, Western blot	24014830
MIRT490431	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT490432	hsa-miR-3192-3p	PAR-CLIP	23592263
MIRT490433	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT490434	hsa-miR-3179	PAR-CLIP	23592263
MIRT490435	hsa-miR-7515	PAR-CLIP	23592263
MIRT490436	hsa-miR-3151-3p	PAR-CLIP	23592263
MIRT490437	hsa-miR-4726-3p	PAR-CLIP	23592263
MIRT490438	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT490439	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT490440	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT490441	hsa-miR-3936	PAR-CLIP	23592263
MIRT490442	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT731661	hsa-miR-223-3p	Luciferase reporter assay	27121304

Transcription factors

Transcription factor	Regulation	Reference
MAL	Unknown	19724058
RUNX1	Unknown	20876458;22898599
SRF	Unknown	19724058

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001725	Component	Stress fiber	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005859	Component	Muscle myosin complex	TAS	2526655
GO:0006936	Process	Muscle contraction	TAS
GO:0006937	Process	Regulation of muscle contraction	TAS	2526655
GO:0008307	Function	Structural constituent of muscle	TAS	2526655
GO:0030018	Component	Z disc	IEA
GO:0032036	Function	Myosin heavy chain binding	IEA
GO:0045652	Process	Regulation of megakaryocyte differentiation	TAS
GO:0070527	Process	Platelet aggregation	HMP	23382103

Other IDs

• MIM: 609905
• HGNC: 15754
• e!Ensembl: ENSG00000101335

Protein

• UniProt ID: P24844
• Protein name: Myosin regulatory light polypeptide 9 (20 kDa myosin light chain) (LC20) (MLC-2C) (Myosin RLC) (Myosin regulatory light chain 2, smooth muscle isoform) (Myosin regulatory light chain 9) (Myosin regulatory light chain MRLC1)
• Protein function: Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion (PubMed:11942626, PubMed:2526655). In myoblasts, may regulate PIEZO1-dependent cortical actomyosin assembly involved in myotube formation (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13405	EF-hand_6	33 → 62	EF-hand domain	Domain
  PF13833	EF-hand_8	114 → 166	EF-hand domain pair	Domain

• Sequence:

  MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
  LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
  DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD

• Sequence length: 172