GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

MYC (MYC proto-oncogene, bHLH transcription factor)

Gene

4609

MYC proto-oncogene, bHLH transcription factor

MYC

MRTL, MYCC, bHLHe39, c-Myc

8q24.21

This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini. [provided by RefSeq, Aug 2017]

Show/Hide all(11)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28933407	C>T	Pathogenic	Coding sequence variant, missense variant
rs121918683	A>C	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs121918684	G>C	Pathogenic	Missense variant, coding sequence variant
rs121918685	C>G	Pathogenic	Missense variant, coding sequence variant
rs750664148	A>C,G	Likely-pathogenic	Missense variant, coding sequence variant
rs756091827	C>G,T	Likely-pathogenic	Missense variant, coding sequence variant
rs775522201	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519849	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519850	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519851	C>G	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519918	C>T	Likely-pathogenic	Missense variant, coding sequence variant

Show/Hide all(242)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000121	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot, Reporter assay;qRT-PCR;Microarray;Other	19748357
MIRT000121	hsa-miR-24-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26159387
MIRT000417	hsa-let-7a-5p	Western blot	20033209
MIRT000417	hsa-let-7a-5p	qRT-PCR	17942906
MIRT000417	hsa-let-7a-5p	qRT-PCR, Western blot	16651716
MIRT000417	hsa-let-7a-5p	TRAP	24510096
MIRT000475	hsa-let-7g-5p	qRT-PCR, Luciferase reporter assay, Western blot, Western blot;qRT-PCR;Other	20309945
MIRT000475	hsa-let-7g-5p	qRT-PCR	21618519
MIRT000475	hsa-let-7g-5p	TRAP	24510096
MIRT000695	hsa-miR-34a-5p	Luciferase reporter assay, Western blot, Reporter assay;Western blot;qRT-PCR;Microarray;Other	19696787
MIRT000695	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21294122
MIRT000695	hsa-miR-34a-5p	qRT-PCR, Western blot	21297663
MIRT000695	hsa-miR-34a-5p	Luciferase reporter assay	22159222
MIRT000695	hsa-miR-34a-5p	Sequencing	20371350
MIRT000695	hsa-miR-34a-5p	TRAP	24510096
MIRT000695	hsa-miR-34a-5p	qRT-PCR, Western blot	25572695
MIRT003438	hsa-miR-98-5p	Luciferase reporter assay, Northern blot, qRT-PCR, ChIP	19528081
MIRT003438	hsa-miR-98-5p	qRT-PCR	17942906
MIRT003438	hsa-miR-98-5p	Microarray	19088304
MIRT003438	hsa-miR-98-5p	TRAP	24510096
MIRT003748	hsa-let-7c-5p	Luciferase reporter assay, Northern blot, Western blot	17877811
MIRT003748	hsa-let-7c-5p	TRAP	24510096
MIRT003968	hsa-miR-26a-5p	Western blot	19524505
MIRT004290	hsa-miR-145-5p	qRT-PCR, Luciferase reporter assay, Western blot	19202062
MIRT004290	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	21092188
MIRT004290	hsa-miR-145-5p	qRT-PCR, Western blot	23710609
MIRT004290	hsa-miR-145-5p	Microarray, qRT-PCR, Western blot	26540468
MIRT004290	hsa-miR-145-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	26354756
MIRT004307	hsa-miR-21-5p	Northern blot, qRT-PCR, ChIP	19528081
MIRT004307	hsa-miR-21-5p	TRAP	24510096
MIRT004401	hsa-miR-34b-5p	Luciferase reporter assay	19461653
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	24398324
MIRT004401	hsa-miR-34b-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT004402	hsa-miR-34c-5p	Luciferase reporter assay	19461653
MIRT004402	hsa-miR-34c-5p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22585994
MIRT004402	hsa-miR-34c-5p	TRAP	24510096
MIRT005288	hsa-miR-17-5p	Western blot	18695042
MIRT005288	hsa-miR-17-5p	CLASH	23622248
MIRT005289	hsa-miR-20a-5p	Western blot	18695042
MIRT005289	hsa-miR-20a-5p	qRT-PCR	24955218
MIRT005319	hsa-miR-34b-3p	Luciferase reporter assay, Western blot	18768788
MIRT005319	hsa-miR-34b-3p	Immunohistochemistry, qRT-PCR	18802929
MIRT005319	hsa-miR-34b-3p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22585994
MIRT005482	hsa-miR-378a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21242960
MIRT006015	hsa-miR-371a-3p	In situ hybridization, Microarray, qRT-PCR	21059911
MIRT006016	hsa-miR-373-3p	In situ hybridization, Microarray, qRT-PCR, Western blot	21059911
MIRT006358	hsa-miR-451a	Luciferase reporter assay	21464222
MIRT006358	hsa-miR-451a	Luciferase reporter assay	25310895
MIRT006358	hsa-miR-451a	Luciferase reporter assay, qRT-PCR, Western blot	27571748
MIRT006820	hsa-miR-33b-5p	Immunohistochemistry, qRT-PCR	22887866
MIRT006820	hsa-miR-33b-5p	Immunohistochemistry, qRT-PCR, Western blot	26729612
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	27292025
MIRT007105	hsa-miR-135a-5p	Luciferase reporter assay, Western blot	23176581
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	24398324
MIRT007105	hsa-miR-135a-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	20371350
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	26701625
MIRT007308	hsa-miR-449c-5p	Luciferase reporter assay	23507140
MIRT007308	hsa-miR-449c-5p	TRAP	24510096
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	24398324
MIRT007308	hsa-miR-449c-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT016647	hsa-miR-429	Reporter assay;Western blot;Other	21684154
MIRT017925	hsa-miR-335-5p	Microarray	18185580
MIRT017925	hsa-miR-335-5p	Western blot	21618216
MIRT032089	hsa-let-7f-5p	qRT-PCR	19956384
MIRT032089	hsa-let-7f-5p	TRAP	24510096
MIRT036232	hsa-miR-320b	CLASH	23622248
MIRT036232	hsa-miR-320b	Luciferase reporter assay, qRT-PCR, Western blot	26487644
MIRT037690	hsa-miR-744-5p	CLASH	23622248
MIRT037690	hsa-miR-744-5p	Luciferase reporter assay, Immunohistochemistry, Western blot	24991193
MIRT038140	hsa-miR-423-5p	CLASH	23622248
MIRT044759	hsa-miR-320a	CLASH	23622248
MIRT044759	hsa-miR-320a	Luciferase reporter assay, qRT-PCR, Western blot	28243124
MIRT052217	hsa-let-7b-5p	CLASH	23622248
MIRT052217	hsa-let-7b-5p	TRAP	24510096
MIRT053199	hsa-miR-148a-3p	Immunoblot, Microarray, qRT-PCR	23389829
MIRT053469	hsa-miR-212-3p	Luciferase reporter assay, qRT-PCR, Western blot	21053104
MIRT053756	hsa-miR-494-3p	Luciferase reporter assay, qRT-PCR, Western blot	24612089
MIRT053756	hsa-miR-494-3p	PAR-CLIP	23592263
MIRT054028	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	24969405
MIRT054238	hsa-miR-33a-5p	Immunoflourescence, Luciferase reporter assay, qRT-PCR, Western blot	23527086
MIRT054238	hsa-miR-33a-5p	TRAP	24510096
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	27292025
MIRT105090	hsa-miR-1294	TRAP	24510096
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	27292025
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	24398324
MIRT105097	hsa-miR-30a-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	20371350
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	26701625
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	24398324
MIRT105098	hsa-miR-30d-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	20371350
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	26701625
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	24398324
MIRT105099	hsa-miR-30e-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	20371350
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	26701625
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	24398324
MIRT105100	hsa-miR-323a-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	20371350
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	26701625
MIRT105101	hsa-miR-449a	TRAP	24510096
MIRT105101	hsa-miR-449a	Luciferase reporter assay, Western blot	27250340
MIRT105103	hsa-miR-940	TRAP	24510096
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	24398324
MIRT105104	hsa-miR-1304-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	26701625
MIRT105105	hsa-miR-1827	PAR-CLIP	24398324
MIRT105105	hsa-miR-1827	PAR-CLIP, HITS-CLIP	21572407
MIRT105105	hsa-miR-1827	PAR-CLIP	20371350
MIRT105105	hsa-miR-1827	PAR-CLIP	26701625
MIRT105107	hsa-miR-2682-5p	TRAP	24510096
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	24398324
MIRT105107	hsa-miR-2682-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	24398324
MIRT105108	hsa-miR-548au-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT105112	hsa-miR-8074	PAR-CLIP	24398324
MIRT105112	hsa-miR-8074	PAR-CLIP, HITS-CLIP	21572407
MIRT105112	hsa-miR-8074	PAR-CLIP	20371350
MIRT105112	hsa-miR-8074	PAR-CLIP	26701625
MIRT105113	hsa-miR-4426	PAR-CLIP	21572407
MIRT105113	hsa-miR-4426	PAR-CLIP	20371350
MIRT105114	hsa-miR-4647	PAR-CLIP	21572407
MIRT105114	hsa-miR-4647	PAR-CLIP	20371350
MIRT105115	hsa-miR-4662b	PAR-CLIP	21572407
MIRT105115	hsa-miR-4662b	PAR-CLIP	20371350
MIRT105121	hsa-miR-4289	PAR-CLIP	23592263
MIRT105124	hsa-miR-16-2-3p	PAR-CLIP	23592263
MIRT105125	hsa-miR-195-3p	PAR-CLIP	23592263
MIRT105126	hsa-miR-5197-5p	PAR-CLIP	23592263
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	24398324
MIRT224345	hsa-miR-6507-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT437853	hsa-miR-487b-3p	ChIP-seq, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23426183
MIRT437962	hsa-miR-7-5p	qRT-PCR	24707474
MIRT438037	hsa-miR-93-5p	qRT-PCR	24367666
MIRT438037	hsa-miR-93-5p	qRT-PCR	24955218
MIRT438063	hsa-miR-324-3p	qRT-PCR	24367666
MIRT438154	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438621	hsa-miR-126-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22972034
MIRT438796	hsa-miR-25-3p	TRAP	24510096
MIRT438796	hsa-miR-25-3p	qRT-PCR	24955218
MIRT438797	hsa-miR-92a-2-5p	qRT-PCR	24955218
MIRT438798	hsa-miR-92a-1-5p	qRT-PCR	24955218
MIRT438799	hsa-miR-19b-2-5p	qRT-PCR	24955218
MIRT438800	hsa-miR-19b-1-5p	qRT-PCR	24955218
MIRT438801	hsa-miR-19a-3p	qRT-PCR	24955218
MIRT438802	hsa-miR-106b-5p	qRT-PCR	24955218
MIRT439087	hsa-miR-92a-3p	TRAP	24510096
MIRT439088	hsa-miR-92b-3p	TRAP	24510096
MIRT439089	hsa-miR-516a-5p	TRAP	24510096
MIRT439090	hsa-miR-455-3p	TRAP	24510096
MIRT439091	hsa-miR-4677-3p	TRAP	24510096
MIRT439092	hsa-miR-4510	TRAP	24510096
MIRT439093	hsa-miR-375	TRAP	24510096
MIRT439096	hsa-miR-3159	TRAP	24510096
MIRT439097	hsa-miR-30d-5p	TRAP	24510096
MIRT439099	hsa-miR-30c-5p	TRAP	24510096
MIRT439101	hsa-miR-23a-3p	TRAP	24510096
MIRT439102	hsa-miR-222-3p	TRAP	24510096
MIRT439103	hsa-miR-196b-5p	TRAP	24510096
MIRT439104	hsa-miR-196a-5p	TRAP	24510096
MIRT439105	hsa-miR-16-5p	TRAP	24510096
MIRT439107	hsa-miR-151a-5p	TRAP	24510096
MIRT439108	hsa-miR-148a-5p	TRAP	24510096
MIRT439110	hsa-miR-125a-3p	TRAP	24510096
MIRT439111	hsa-miR-125a-5p	TRAP	24510096
MIRT439112	hsa-miR-1248	TRAP	24510096
MIRT439133	hsa-let-7i-5p	TRAP	24510096
MIRT439135	hsa-let-7e-5p	TRAP	24510096
MIRT439137	hsa-let-7d-5p	TRAP	24510096
MIRT454974	hsa-miR-302a-5p	PAR-CLIP	23592263
MIRT454975	hsa-miR-3919	PAR-CLIP	23592263
MIRT454976	hsa-miR-4699-3p	PAR-CLIP	23592263
MIRT454977	hsa-miR-4797-5p	PAR-CLIP	23592263
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	24398324
MIRT499105	hsa-miR-6765-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	20371350
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	26701625
MIRT499106	hsa-miR-622	PAR-CLIP	24398324
MIRT499106	hsa-miR-622	PAR-CLIP, HITS-CLIP	21572407
MIRT499106	hsa-miR-622	PAR-CLIP	20371350
MIRT499106	hsa-miR-622	PAR-CLIP	26701625
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	24398324
MIRT499107	hsa-miR-135b-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	20371350
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	26701625
MIRT499108	hsa-miR-889-5p	PAR-CLIP	24398324
MIRT499108	hsa-miR-889-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT499108	hsa-miR-889-5p	PAR-CLIP	20371350
MIRT499108	hsa-miR-889-5p	PAR-CLIP	26701625
MIRT550564	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT550564	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT550565	hsa-miR-4762-5p	PAR-CLIP	21572407
MIRT550565	hsa-miR-4762-5p	PAR-CLIP	20371350
MIRT550566	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT550566	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT550567	hsa-miR-3133	PAR-CLIP	21572407
MIRT550567	hsa-miR-3133	PAR-CLIP	20371350
MIRT731172	hsa-miR-130a-3p	Luciferase reporter assay	25544755
MIRT733156	hsa-miR-25-5p	qRT-PCR, Western blot	27120728
MIRT733170	hsa-miR-185-5p	qRT-PCR, Western blot	27250838
MIRT733427	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26771839
MIRT733545	hsa-miR-561-3p	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	27725860
MIRT733768	hsa-miR-34a-3p	Luciferase reporter assay	26335888
MIRT733881	hsa-miR-599	Luciferase reporter assay, qRT-PCR, Western blot	27398141
MIRT735343	hsa-miR-29b-3p	Immunoblot, Luciferase reporter assay	26180082
MIRT735344	hsa-miR-129-2-3p	Immunoblot, Luciferase reporter assay	26180082
MIRT740456	hsa-miR-3157-5p	PAR-CLIP	26701625
MIRT740456	hsa-miR-3157-5p	PAR-CLIP	27292025
MIRT742696	hsa-miR-377-5p	PAR-CLIP	26701625
MIRT742696	hsa-miR-377-5p	PAR-CLIP	27292025
MIRT744001	hsa-miR-4316	PAR-CLIP	26701625
MIRT744001	hsa-miR-4316	PAR-CLIP	27292025
MIRT744341	hsa-miR-4432	PAR-CLIP	26701625
MIRT744341	hsa-miR-4432	PAR-CLIP	27292025
MIRT747092	hsa-miR-4691-3p	PAR-CLIP	26701625
MIRT747092	hsa-miR-4691-3p	PAR-CLIP	27292025
MIRT749757	hsa-miR-512-5p	PAR-CLIP	26701625
MIRT749757	hsa-miR-512-5p	PAR-CLIP	27292025
MIRT749782	hsa-miR-513c-5p	PAR-CLIP	26701625
MIRT749782	hsa-miR-513c-5p	PAR-CLIP	27292025
MIRT749788	hsa-miR-514b-5p	PAR-CLIP	26701625
MIRT749788	hsa-miR-514b-5p	PAR-CLIP	27292025
MIRT751547	hsa-miR-586	PAR-CLIP	26701625
MIRT751547	hsa-miR-586	PAR-CLIP	27292025
MIRT751850	hsa-miR-6086	PAR-CLIP	26701625
MIRT751850	hsa-miR-6086	PAR-CLIP	27292025
MIRT753479	hsa-miR-655-5p	PAR-CLIP	26701625
MIRT753479	hsa-miR-655-5p	PAR-CLIP	27292025

Transcription factors

Show/Hide all(93)

Transcription factor	Regulation	Reference
AATF	Activation	20549547
AHR	Unknown	11114727;16091746
APC	Repression	16510874
AR	Unknown	24512546
BCL6	Activation	21394099
BDP1	Unknown	12734418
BIN1	Unknown	9797456
BRCA1	Unknown	12032322;12646176
CEBPA	Repression	12032779
CEBPE	Repression	12947005
CHD8	Unknown	16949368
CNBP	Unknown	23774591
CTCF	Activation	19568426
CTCF	Repression	12032779;12524457
CTCF	Unknown	24725430;9591631
CTNNB1	Activation	20300972;21533051
CTNNB1	Unknown	17724465;18679417;19662654;19778454
DLX5	Activation	19497851
E2F1	Activation	11705881
E2F4	Unknown	17132729
E2F5	Unknown	17132729
ENO1	Repression	10681589;9119380
ENO1	Unknown	10528225;10802057;18490439;20412594;7880838
EP300	Repression	19279113
ESR1	Unknown	11517191;19569049;22892083
ETS2	Unknown	22108824
EZH2	Repression	23079660
FOS	Repression	2498162
FOXA1	Unknown	24512546
FOXM1	Activation	23804320
FUBP1	Unknown	11239393;18193062;24117486
HDAC11	Unknown	20493879
HDAC2	Unknown	20493879
HDAC3	Repression	19279113;23079660;23714368
HIC1	Repression	24067369
HNF4A	Activation	23714368
HOXA1	Activation	15665309
IFI16	Repression	20052289
JUN	Repression	2498162
L3MBTL1	Unknown	23543057
LEF1	Unknown	19620402
MAX	Unknown	9797456
MTA1	Unknown	12431981
MXI1	Repression	8838813
MYB	Activation	1594249
MYB	Unknown	11259163;16088151;19609274
MYBL2	Activation	1594249
NF1	Activation	9562250
NFKB1	Activation	17018379
NFKB1	Repression	18566231
NFKB1	Unknown	11114727;12894581;17673602;17944672;18184402;19469019;19766095;21790895
PGR	Unknown	22892083
PPARG	Repression	11973610
PRDM1	Repression	10713181;12032779
PTTG1	Activation	22475756
PTTG1	Unknown	11115508
RB1	Repression	10200487;9671466
RB1	Unknown	7680889
RBL1	Unknown	17132729;9797456
RELA	Activation	17018379
RELA	Repression	18566231
RELA	Unknown	11114727;12894581;17673602;17944672;18184402;19469019;19766095;21790895
RFX1	Repression	10918054;12032779
RUNX3	Repression	20442291
SIRT1	Repression	22245592;22483777
SMAD3	Unknown	17132729
SMAD4	Unknown	17132729
SMAD7	Activation	15555279
SNIP1	Unknown	17157259
SP1	Unknown	2057364;8355712
SRSF1	Unknown	22545246
STAT3	Activation	15184887;17204573;19259613
STAT3	Repression	20067773;22317895
STAT3	Unknown	10464281;15469392;18184402;20654581
STAT4	Activation	10702306
TBL1X	Unknown	20493879
TBP	Unknown	7880838;9797456
TCF3	Activation	22384858
TCF3	Repression	21788410
TCF4	Activation	21533051
TCF4	Unknown	15928669;19561604;19662654;19778454
TLX1	Activation	20618946
TP53	Repression	19411072
TP53	Unknown	19202062
WDR5	Unknown	24782528
WT1	Repression	17634147
WT1	Unknown	15286719
YY1	Activation	18490439
YY1	Repression	19279113
YY1	Unknown	10528225;17434929;9797456
ZBTB7A	Repression	17189472
ZNF300	Activation	21777376
ZNF382	Repression	20682794

Show/Hide all(80)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	9924025, 19160485
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	19786833
GO:0000165	Process	MAPK cascade	IMP	17873522
GO:0000785	Component	Chromatin	IMP	12837246
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	10723141
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	19786833
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IMP	25956029
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001046	Function	Core promoter sequence-specific DNA binding	IDA	30873824
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IMP	19786833
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	10723141
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	ISS
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	ISS
GO:0003677	Function	DNA binding	ISS
GO:0003677	Function	DNA binding	TAS	10597290
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9924025
GO:0005515	Function	Protein binding	IPI	9308237, 9708738, 10597290, 11891322, 12706874, 15103331, 15674325, 15992821, 16352593, 16606833, 16996503, 17070091, 17157259, 17314511, 17418410, 17599065, 17632056, 17873522, 18256156, 18393360, 18413597, 18620061, 18923429, 19131971, 19786833, 20195357, 20208519, 20551172, 20691
GO:0005634	Component	Nucleus	IDA	11793365, 15358760, 15994933
GO:0005654	Component	Nucleoplasm	IDA	17558397
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	17558397, 25775507
GO:0006112	Process	Energy reserve metabolic process	NAS	9924025
GO:0006338	Process	Chromatin remodeling	IDA	21533051
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS
GO:0006879	Process	Cellular iron ion homeostasis	IDA	9924025
GO:0006974	Process	Cellular response to DNA damage stimulus	IDA	17873522
GO:0007050	Process	Cell cycle arrest	IDA	10962037
GO:0007219	Process	Notch signaling pathway	TAS
GO:0008134	Function	Transcription factor binding	IPI	15674325
GO:0008284	Process	Positive regulation of cell population proliferation	IBA	21873635
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	15994933, 19160485
GO:0010332	Process	Response to gamma radiation	IDA	19179467
GO:0010468	Process	Regulation of gene expression	IDA	21447833
GO:0010628	Process	Positive regulation of gene expression	IDA	15459207
GO:0010628	Process	Positive regulation of gene expression	IGI	15459207
GO:0015671	Process	Oxygen transport	NAS	9924025
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0032204	Process	Regulation of telomere maintenance	IMP	17765874
GO:0032873	Process	Negative regulation of stress-activated MAPK cascade	ISS
GO:0032986	Process	Protein-DNA complex disassembly	IDA	19160485
GO:0032991	Component	Protein-containing complex	IDA	17873522, 19160485
GO:0033613	Function	Activating transcription factor binding	IPI	19160485
GO:0034644	Process	Cellular response to UV	IEP	17873522
GO:0035690	Process	Cellular response to drug	IDA	17873522, 19179467
GO:0042493	Process	Response to drug	IEP	18291362
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0043280	Process	Positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	19179467
GO:0044346	Process	Fibroblast apoptotic process	TAS	10962037
GO:0044877	Function	Protein-containing complex binding	IDA	18987311
GO:0045656	Process	Negative regulation of monocyte differentiation	IMP	9924025
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	10962037, 17558397, 18818310
GO:0045893	Process	Positive regulation of transcription, DNA-templated	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10723141
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	9924025
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	9924025, 18987311
GO:0048146	Process	Positive regulation of fibroblast proliferation	IMP	15674325
GO:0048147	Process	Negative regulation of fibroblast proliferation	IDA	10962037
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IDA	18987311
GO:0051276	Process	Chromosome organization	IDA	10962037
GO:0051782	Process	Negative regulation of cell division	IDA	10962037
GO:0051973	Process	Positive regulation of telomerase activity	ISS
GO:0070371	Process	ERK1 and ERK2 cascade	IDA	15459207
GO:0070491	Function	Repressing transcription factor binding	IPI	15674325
GO:0070848	Process	Response to growth factor	TAS	18987311
GO:0070888	Function	E-box binding	IDA	18818310
GO:0071456	Process	Cellular response to hypoxia	IDA	15459207
GO:0090096	Process	Positive regulation of metanephric cap mesenchymal cell proliferation	ISS
GO:1904672	Process	Regulation of somatic stem cell population maintenance	ISS
GO:1904837	Process	Beta-catenin-TCF complex assembly	TAS
GO:1905643	Process	Positive regulation of DNA methylation	IMP	19786833
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IMP	9924025
GO:2001022	Process	Positive regulation of response to DNA damage stimulus	IDA	19179467

MIM	HGNC	e!Ensembl
190080	7553	ENSG00000136997

Protein

UniProt ID

P01106

Protein name

Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)

Protein function

Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis (PubMed:24940000). Regulator of somatic reprogramming, controls self-renewal of embryonic stem cells. Functions with TAF6L to activate target gene expression through RNA polymerase II pause release (By similarity).

PDB

1A93 , 1EE4 , 1MV0 , 1NKP , 2A93 , 2OR9 , 4Y7R , 5I4Z , 5I50 , 6C4U , 6E16 , 6E24 , 6G6J , 6G6K , 6G6L

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01056	Myc_N	1 → 345	Myc amino-terminal region	Family
PF00010	HLH	355 → 407	Helix-loop-helix DNA-binding domain	Domain
PF02344	Myc-LZ	408 → 438	Myc leucine zipper domain	Coiled-coil

Sequence

MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL
RKRREQLKHKLEQLRNSCA

Sequence length

439

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412