MTOR (mechanistic target of rapamycin kinase)

Gene

• Entrez ID: 2475
• Gene name: Mechanistic target of rapamycin kinase
• Gene symbol: MTOR
• Synonyms: FRAP, FRAP1, FRAP2, RAFT1, RAPT1, SKS
• Chromosome: 1
• Chromosome location: 1p36.22
• Summary: The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This kinase is a component of two distinct complexes, mT

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs55881943	C>T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant, non coding transcript variant
rs147774167	G>A	Conflicting-interpretations-of-pathogenicity	Missense variant, 5 prime UTR variant, coding sequence variant, non coding transcript variant
rs587777893	G>A,T	Not-provided, pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant, non coding transcript variant
rs587777894	G>A,T	Pathogenic, likely-pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant, non coding transcript variant
rs587777900	C>T	Likely-pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant, non coding transcript variant
rs774204282	G>A,C	Likely-pathogenic	Coding sequence variant, non coding transcript variant, synonymous variant, missense variant, genic downstream transcript variant
rs778855567	C>A,T	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs786205165	C>A,T	Pathogenic, likely-pathogenic	Non coding transcript variant, coding sequence variant, genic downstream transcript variant, missense variant
rs863225264	C>T	Pathogenic, uncertain-significance	Non coding transcript variant, coding sequence variant, genic downstream transcript variant, missense variant
rs869312666	A>C	Pathogenic	Non coding transcript variant, coding sequence variant, genic downstream transcript variant, missense variant
rs878855328	C>T	Pathogenic	Missense variant, coding sequence variant, intron variant, genic downstream transcript variant
rs1057519777	C>G,T	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs1057519778	G>T	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs1057519779	A>G	Likely-pathogenic, pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs1057519780	C>T	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs1057519913	G>C	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs1057519914	A>G	Likely-pathogenic, pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs1057519915	A>C	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs1057519916	T>A	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs1057519917	A>G,T	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs1057524044	A>G	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs1057524049	C>T	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs1085307113	A>G,T	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs1085307114	A>C	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs1557739557	C>A,T	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant, genic downstream transcript variant, non coding transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006146	hsa-miR-99a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21878637
MIRT006146	hsa-miR-99a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21878637
MIRT006155	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006155	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006157	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006157	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006146	hsa-miR-99a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21878637
MIRT006146	hsa-miR-99a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21878637
MIRT006155	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006155	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006157	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006157	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006627	mmu-miR-100-5p	Immunohistochemistry, Microarray, qRT-PCR, Western blot	21339483
MIRT006146	hsa-miR-99a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21878637
MIRT006146	hsa-miR-99a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21878637
MIRT006155	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006155	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006157	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006157	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006627	mmu-miR-100-5p	Immunohistochemistry, Microarray, qRT-PCR, Western blot	21339483
MIRT006146	hsa-miR-99a-5p	FACS, Luciferase reporter assay, qRT-PCR, Western blot	22299047
MIRT006564	hsa-miR-99b-5p	FACS, Luciferase reporter assay, qRT-PCR, Western blot	22299047
MIRT006872	hsa-miR-144-3p	Luciferase reporter assay	22983984
MIRT006872	hsa-miR-144-3p	Luciferase reporter assay	22983984
MIRT007365	hsa-miR-100-5p	Luciferase reporter assay, qRT-PCR, Western blot	23292834
MIRT007365	hsa-miR-100-5p	Luciferase reporter assay, qRT-PCR, Western blot	23292834
MIRT006146	hsa-miR-99a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23292834
MIRT006146	hsa-miR-99a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23292834
MIRT006146	hsa-miR-99a-5p	Reporter assay;Western blot	21383697
MIRT031485	hsa-miR-16-5p	Proteomics	18668040
MIRT047241	hsa-miR-181b-5p	CLASH	23622248
MIRT037492	hsa-miR-744-5p	CLASH	23622248
MIRT006146	hsa-miR-99a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22751686
MIRT006146	hsa-miR-99a-5p	Luciferase reporter assay, Western blot	23762265
MIRT006146	hsa-miR-99a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23173671
MIRT006564	hsa-miR-99b-5p	Luciferase reporter assay, qRT-PCR, Western blot	24668416
MIRT006564	hsa-miR-99b-5p	Luciferase reporter assay, qRT-PCR, Western blot	24668416
MIRT006146	hsa-miR-99a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24668416
MIRT006146	hsa-miR-99a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24668416
MIRT006146	hsa-miR-99a-5p	MCF-7	24637915
MIRT006146	hsa-miR-99a-5p	ChIP-seq, Flow, Immunohistochemistry, Immunoprecipitaion, qRT-PCR, Western blot	24810364
MIRT054040	hsa-miR-101-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	22989749
MIRT007365	hsa-miR-100-5p	qRT-PCR, Western blot	23778488
MIRT006146	hsa-miR-99a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24312487
MIRT026023	hsa-miR-199a-3p	Immunofluorescence, Microarray, QRTPCR, Western blot	24810336
MIRT006146	hsa-miR-99a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	25348507
MIRT437347	hsa-let-7c-5p	Luciferase reporter assay	25311506
MIRT437347	hsa-let-7c-5p	Luciferase reporter assay	25311506
MIRT031485	hsa-miR-16-5p	Luciferase reporter assay	25311506
MIRT031485	hsa-miR-16-5p	Luciferase reporter assay	25311506
MIRT006146	hsa-miR-99a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23893385
MIRT007365	hsa-miR-100-5p	FACS, Luciferase reporter assay, qRT-PCR, Western blot	24030073
MIRT006146	hsa-miR-99a-5p	FACS, Luciferase reporter assay, qRT-PCR, Western blot	24030073
MIRT007365	hsa-miR-100-5p	Luciferase reporter assay	23270926
MIRT026023	hsa-miR-199a-3p	Luciferase reporter assay, Wetsern blot, qRT-PCR	24378853
MIRT007365	hsa-miR-100-5p	Luciferase reporter assay	23270926
MIRT026023	hsa-miR-199a-3p	Luciferase reporter assay, Wetsern blot, qRT-PCR	24378853
MIRT440200	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440200	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT006564	hsa-miR-99b-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26259252
MIRT006564	hsa-miR-99b-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26259252
MIRT026023	hsa-miR-199a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26051997
MIRT006872	hsa-miR-144-3p	Immunofluorescence, Western blot	26687302
MIRT006872	hsa-miR-144-3p	Immunofluorescence, Western blot	26687302
MIRT006872	hsa-miR-144-3p	Immunofluorescence, Western blot	26687302
MIRT006872	hsa-miR-144-3p	Immunofluorescence, Western blot	26687302
MIRT006872	hsa-miR-144-3p	Immunofluorescence, Western blot	26687302
MIRT006872	hsa-miR-144-3p	Immunofluorescence, Western blot	26687302
MIRT006872	hsa-miR-144-3p	Immunofluorescence, Western blot	26687302
MIRT006872	hsa-miR-144-3p	Immunofluorescence, Western blot	26687302
MIRT006146	hsa-miR-99a-5p	Luciferase reporter assay	27158364
MIRT006146	hsa-miR-99a-5p	Luciferase reporter assay	27158364
MIRT054040	hsa-miR-101-3p	qRT-PCR, Western blot	26458815
MIRT026023	hsa-miR-199a-3p	Immunofluorescence, qRT-PCR, Western blot, Immunohistochemistry analysis	25854175
MIRT026023	hsa-miR-199a-3p	Immunofluorescence, qRT-PCR, Western blot, Immunohistochemistry analysis	25854175
MIRT006872	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR, Western blot	27072960
MIRT006872	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR, Western blot	27072960
MIRT006872	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR, Western blot	27072960
MIRT006872	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR, Western blot	27072960
MIRT006872	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR, Western blot	27072960
MIRT006872	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR, Western blot	27072960
MIRT006872	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR, Western blot	27072960
MIRT006872	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR, Western blot	27072960
MIRT006872	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR, Western blot	27072960
MIRT007365	hsa-miR-100-5p	Western blot	26744318
MIRT006146	hsa-miR-99a-5p	Flow, Immunohistochemistry, qRT-PCR, Western blot	28387375
MIRT006872	hsa-miR-144-3p	RNA-seq	32751854
MIRT733207	hsa-miR-324-3p	RNA-seq	32751854
MIRT733208	hsa-miR-451a	RNA-seq	32751854
MIRT733209	hsa-miR-18a-5p	RNA-seq	32751854
MIRT006872	hsa-miR-144-3p	RNA-seq	32751854
MIRT006872	hsa-miR-144-3p	RNA-seq	32751854
MIRT733459	hsa-miR-26b-5p	RNA-seq, qRT-PCR	34209741
MIRT733614	hsa-miR-342-3p	Luciferase reporter assay, qRT-PCR, Western blotting	34055578
MIRT734783	hsa-miR-3129-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33336524
MIRT734933	hsa-miR-19b-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), Immunofluorescence	33332749
MIRT006564	hsa-miR-99b-5p	Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	31819515
MIRT735922	hsa-miR-641	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), qRT-PCR	32423991
MIRT006564	hsa-miR-99b-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32608991
MIRT026023	hsa-miR-199a-3p	Western blotting, qRT-PCR	31789347
MIRT054040	hsa-miR-101-3p	Western blotting, Immunoprecipitaion (IP), RNA-seq, Immunofluorescence, qRT-PCR, Flow cytometry	32326380
MIRT026023	hsa-miR-199a-3p	Western blotting	31898515
MIRT755644	hsa-miR-7-5p	Luciferase reporter assay, Western blotting, qRT-PCR	37745037
MIRT006872	hsa-miR-144-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP)	38225540
MIRT006564	hsa-miR-99b-5p	Western blotting, Microarray, qRT-PCR, Immunohistochemistry (IHC), Immunofluorescence	36077039
MIRT1164567	hsa-miR-100	CLIP-seq
MIRT1164568	hsa-miR-1207-5p	CLIP-seq
MIRT1164569	hsa-miR-1294	CLIP-seq
MIRT1164570	hsa-miR-1323	CLIP-seq
MIRT1164571	hsa-miR-1909	CLIP-seq
MIRT1164572	hsa-miR-224	CLIP-seq
MIRT1164573	hsa-miR-3182	CLIP-seq
MIRT1164574	hsa-miR-4263	CLIP-seq
MIRT1164575	hsa-miR-4310	CLIP-seq
MIRT1164576	hsa-miR-4424	CLIP-seq
MIRT1164577	hsa-miR-4509	CLIP-seq
MIRT1164578	hsa-miR-4710	CLIP-seq
MIRT1164579	hsa-miR-4736	CLIP-seq
MIRT1164580	hsa-miR-4744	CLIP-seq
MIRT1164581	hsa-miR-4763-3p	CLIP-seq
MIRT1164582	hsa-miR-4799-5p	CLIP-seq
MIRT1164583	hsa-miR-548o	CLIP-seq
MIRT1164584	hsa-miR-561	CLIP-seq
MIRT1164585	hsa-miR-576-5p	CLIP-seq
MIRT1164586	hsa-miR-581	CLIP-seq
MIRT1164587	hsa-miR-99a	CLIP-seq
MIRT1164588	hsa-miR-99b	CLIP-seq
MIRT1551423	hsa-miR-4698	CLIP-seq
MIRT2047442	hsa-miR-1208	CLIP-seq
MIRT2047443	hsa-miR-1272	CLIP-seq
MIRT2047444	hsa-miR-1292	CLIP-seq
MIRT2047445	hsa-miR-1322	CLIP-seq
MIRT2047446	hsa-miR-1343	CLIP-seq
MIRT2047447	hsa-miR-2117	CLIP-seq
MIRT2047448	hsa-miR-2467-5p	CLIP-seq
MIRT2047449	hsa-miR-298	CLIP-seq
MIRT2047450	hsa-miR-3134	CLIP-seq
MIRT2047451	hsa-miR-3158-5p	CLIP-seq
MIRT2047452	hsa-miR-3190	CLIP-seq
MIRT2047453	hsa-miR-338-5p	CLIP-seq
MIRT2047454	hsa-miR-3591-5p	CLIP-seq
MIRT2047455	hsa-miR-3681	CLIP-seq
MIRT2047456	hsa-miR-370	CLIP-seq
MIRT2047457	hsa-miR-3975	CLIP-seq
MIRT2047458	hsa-miR-421	CLIP-seq
MIRT2047459	hsa-miR-4273	CLIP-seq
MIRT2047460	hsa-miR-4307	CLIP-seq
MIRT2047461	hsa-miR-4328	CLIP-seq
MIRT2047462	hsa-miR-4420	CLIP-seq
MIRT2047463	hsa-miR-4460	CLIP-seq
MIRT2047464	hsa-miR-4471	CLIP-seq
MIRT2047465	hsa-miR-4493	CLIP-seq
MIRT2047466	hsa-miR-4502	CLIP-seq
MIRT2047467	hsa-miR-4534	CLIP-seq
MIRT2047468	hsa-miR-4646-5p	CLIP-seq
MIRT2047469	hsa-miR-4649-3p	CLIP-seq
MIRT2047470	hsa-miR-4663	CLIP-seq
MIRT2047471	hsa-miR-4682	CLIP-seq
MIRT2047472	hsa-miR-4687-3p	CLIP-seq
MIRT2047473	hsa-miR-4709-5p	CLIP-seq
MIRT2047474	hsa-miR-4716-5p	CLIP-seq
MIRT2047475	hsa-miR-4727-3p	CLIP-seq
MIRT2047476	hsa-miR-4729	CLIP-seq
MIRT2047477	hsa-miR-4753-5p	CLIP-seq
MIRT2047478	hsa-miR-4762-3p	CLIP-seq
MIRT2047479	hsa-miR-485-5p	CLIP-seq
MIRT2047480	hsa-miR-515-5p	CLIP-seq
MIRT2047481	hsa-miR-544b	CLIP-seq
MIRT2047482	hsa-miR-545	CLIP-seq
MIRT1164586	hsa-miR-581	CLIP-seq
MIRT2047483	hsa-miR-646	CLIP-seq
MIRT2047484	hsa-miR-647	CLIP-seq
MIRT2047485	hsa-miR-671-5p	CLIP-seq
MIRT2047486	hsa-miR-7	CLIP-seq
MIRT1164568	hsa-miR-1207-5p	CLIP-seq
MIRT2047444	hsa-miR-1292	CLIP-seq
MIRT1164569	hsa-miR-1294	CLIP-seq
MIRT2047446	hsa-miR-1343	CLIP-seq
MIRT2276371	hsa-miR-144	CLIP-seq
MIRT1164571	hsa-miR-1909	CLIP-seq
MIRT2047449	hsa-miR-298	CLIP-seq
MIRT2047451	hsa-miR-3158-5p	CLIP-seq
MIRT1164573	hsa-miR-3182	CLIP-seq
MIRT2047452	hsa-miR-3190	CLIP-seq
MIRT2047453	hsa-miR-338-5p	CLIP-seq
MIRT2047454	hsa-miR-3591-5p	CLIP-seq
MIRT2276372	hsa-miR-3660	CLIP-seq
MIRT2047455	hsa-miR-3681	CLIP-seq
MIRT2047456	hsa-miR-370	CLIP-seq
MIRT2047458	hsa-miR-421	CLIP-seq
MIRT2276373	hsa-miR-4256	CLIP-seq
MIRT2276374	hsa-miR-4305	CLIP-seq
MIRT1164575	hsa-miR-4310	CLIP-seq
MIRT2276375	hsa-miR-4312	CLIP-seq
MIRT2047463	hsa-miR-4460	CLIP-seq
MIRT2047464	hsa-miR-4471	CLIP-seq
MIRT2047465	hsa-miR-4493	CLIP-seq
MIRT2047466	hsa-miR-4502	CLIP-seq
MIRT2276376	hsa-miR-4526	CLIP-seq
MIRT2047468	hsa-miR-4646-5p	CLIP-seq
MIRT2276377	hsa-miR-4699-3p	CLIP-seq
MIRT2047473	hsa-miR-4709-5p	CLIP-seq
MIRT1164578	hsa-miR-4710	CLIP-seq
MIRT2276378	hsa-miR-4711-3p	CLIP-seq
MIRT2047475	hsa-miR-4727-3p	CLIP-seq
MIRT1164579	hsa-miR-4736	CLIP-seq
MIRT2047477	hsa-miR-4753-5p	CLIP-seq
MIRT2047478	hsa-miR-4762-3p	CLIP-seq
MIRT1164581	hsa-miR-4763-3p	CLIP-seq
MIRT2276379	hsa-miR-511	CLIP-seq
MIRT2047482	hsa-miR-545	CLIP-seq
MIRT2276380	hsa-miR-548a-5p	CLIP-seq
MIRT2276381	hsa-miR-548ab	CLIP-seq
MIRT2276382	hsa-miR-548ak	CLIP-seq
MIRT2276383	hsa-miR-548b-5p	CLIP-seq
MIRT2276384	hsa-miR-548c-5p	CLIP-seq
MIRT2276385	hsa-miR-548d-5p	CLIP-seq
MIRT2276386	hsa-miR-548h	CLIP-seq
MIRT2276387	hsa-miR-548i	CLIP-seq
MIRT2276388	hsa-miR-548j	CLIP-seq
MIRT2276389	hsa-miR-548k	CLIP-seq
MIRT2276390	hsa-miR-548l	CLIP-seq
MIRT2276391	hsa-miR-548w	CLIP-seq
MIRT2276392	hsa-miR-548y	CLIP-seq
MIRT2276393	hsa-miR-559	CLIP-seq
MIRT1164586	hsa-miR-581	CLIP-seq
MIRT2276394	hsa-miR-582-5p	CLIP-seq
MIRT2047483	hsa-miR-646	CLIP-seq
MIRT2047485	hsa-miR-671-5p	CLIP-seq
MIRT2047449	hsa-miR-298	CLIP-seq
MIRT2047451	hsa-miR-3158-5p	CLIP-seq
MIRT2047456	hsa-miR-370	CLIP-seq
MIRT2047465	hsa-miR-4493	CLIP-seq
MIRT2047477	hsa-miR-4753-5p	CLIP-seq
MIRT2047478	hsa-miR-4762-3p	CLIP-seq
MIRT2431286	hsa-miR-375	CLIP-seq
MIRT2047459	hsa-miR-4273	CLIP-seq
MIRT2431287	hsa-miR-4677-5p	CLIP-seq
MIRT2431288	hsa-miR-767-3p	CLIP-seq
MIRT1164569	hsa-miR-1294	CLIP-seq
MIRT2575277	hsa-miR-101	CLIP-seq
MIRT2575278	hsa-miR-1202	CLIP-seq
MIRT2575279	hsa-miR-1244	CLIP-seq
MIRT2575280	hsa-miR-1245	CLIP-seq
MIRT2575281	hsa-miR-128	CLIP-seq
MIRT2575282	hsa-miR-1293	CLIP-seq
MIRT2276371	hsa-miR-144	CLIP-seq
MIRT2575283	hsa-miR-199b-3p	CLIP-seq
MIRT2575284	hsa-miR-2113	CLIP-seq
MIRT2047449	hsa-miR-298	CLIP-seq
MIRT2575285	hsa-miR-3065-3p	CLIP-seq
MIRT2575286	hsa-miR-3156-3p	CLIP-seq
MIRT2047451	hsa-miR-3158-5p	CLIP-seq
MIRT2575287	hsa-miR-3168	CLIP-seq
MIRT2575288	hsa-miR-3194-5p	CLIP-seq
MIRT2575289	hsa-miR-323-5p	CLIP-seq
MIRT2575290	hsa-miR-323b-3p	CLIP-seq
MIRT2047453	hsa-miR-338-5p	CLIP-seq
MIRT2575291	hsa-miR-339-5p	CLIP-seq
MIRT2047456	hsa-miR-370	CLIP-seq
MIRT2431286	hsa-miR-375	CLIP-seq
MIRT2575292	hsa-miR-3972	CLIP-seq
MIRT2047458	hsa-miR-421	CLIP-seq
MIRT2047459	hsa-miR-4273	CLIP-seq
MIRT2575293	hsa-miR-4281	CLIP-seq
MIRT2575294	hsa-miR-4291	CLIP-seq
MIRT2575295	hsa-miR-4301	CLIP-seq
MIRT2276374	hsa-miR-4305	CLIP-seq
MIRT2575296	hsa-miR-4483	CLIP-seq
MIRT2047465	hsa-miR-4493	CLIP-seq
MIRT2431287	hsa-miR-4677-5p	CLIP-seq
MIRT2575297	hsa-miR-4686	CLIP-seq
MIRT1551423	hsa-miR-4698	CLIP-seq
MIRT2047473	hsa-miR-4709-5p	CLIP-seq
MIRT2047476	hsa-miR-4729	CLIP-seq
MIRT2047477	hsa-miR-4753-5p	CLIP-seq
MIRT2047479	hsa-miR-485-5p	CLIP-seq
MIRT2575298	hsa-miR-570	CLIP-seq
MIRT2575299	hsa-miR-579	CLIP-seq
MIRT2575300	hsa-miR-607	CLIP-seq
MIRT2047483	hsa-miR-646	CLIP-seq
MIRT2575301	hsa-miR-659	CLIP-seq
MIRT2575302	hsa-miR-670	CLIP-seq
MIRT2431288	hsa-miR-767-3p	CLIP-seq
MIRT2575303	hsa-miR-889	CLIP-seq
MIRT2575280	hsa-miR-1245	CLIP-seq
MIRT2575281	hsa-miR-128	CLIP-seq
MIRT2575282	hsa-miR-1293	CLIP-seq
MIRT2575284	hsa-miR-2113	CLIP-seq
MIRT2047449	hsa-miR-298	CLIP-seq
MIRT2575286	hsa-miR-3156-3p	CLIP-seq
MIRT2047451	hsa-miR-3158-5p	CLIP-seq
MIRT2575289	hsa-miR-323-5p	CLIP-seq
MIRT2047453	hsa-miR-338-5p	CLIP-seq
MIRT2575291	hsa-miR-339-5p	CLIP-seq
MIRT2047456	hsa-miR-370	CLIP-seq
MIRT2431286	hsa-miR-375	CLIP-seq
MIRT2047458	hsa-miR-421	CLIP-seq
MIRT2047459	hsa-miR-4273	CLIP-seq
MIRT2575293	hsa-miR-4281	CLIP-seq
MIRT2575295	hsa-miR-4301	CLIP-seq
MIRT2276374	hsa-miR-4305	CLIP-seq
MIRT2575296	hsa-miR-4483	CLIP-seq
MIRT2047465	hsa-miR-4493	CLIP-seq
MIRT2431287	hsa-miR-4677-5p	CLIP-seq
MIRT2575297	hsa-miR-4686	CLIP-seq
MIRT2047473	hsa-miR-4709-5p	CLIP-seq
MIRT2047477	hsa-miR-4753-5p	CLIP-seq
MIRT2575298	hsa-miR-570	CLIP-seq
MIRT2047483	hsa-miR-646	CLIP-seq
MIRT2575301	hsa-miR-659	CLIP-seq
MIRT2575302	hsa-miR-670	CLIP-seq
MIRT2431288	hsa-miR-767-3p	CLIP-seq
MIRT2575303	hsa-miR-889	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0001002	Function	RNA polymerase III type 1 promoter sequence-specific DNA binding	IDA	20233713
GO:0001003	Function	RNA polymerase III type 2 promoter sequence-specific DNA binding	IDA	20233713
GO:0001006	Function	RNA polymerase III type 3 promoter sequence-specific DNA binding	IDA	20233713
GO:0001156	Function	TFIIIC-class transcription factor complex binding	IDA	20543138
GO:0001558	Process	Regulation of cell growth	IDA	18762023
GO:0001933	Process	Negative regulation of protein phosphorylation	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0002296	Process	T-helper 1 cell lineage commitment	IEA
GO:0003007	Process	Heart morphogenesis	IEA
GO:0003179	Process	Heart valve morphogenesis	IEA
GO:0004672	Function	Protein kinase activity	IDA	12150926
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	22768106
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	12718876, 15467718, 22343943, 22576015, 22692423, 30704899
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	10089303, 11438723, 12150925, 12150926, 12408816, 15467718, 16915281, 17148612, 17461779, 17565979, 18339839, 18550814, 18566587, 18955708, 19446321, 19619545, 19875983, 20080789, 20543138, 20562859, 20864032, 21045808, 21376236, 21471201, 21614075, 22307628, 22343943, 22424946, 225
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005635	Component	Nuclear envelope	IDA	25294810
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	11853878, 20381137
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005764	Component	Lysosome	IDA	20381137, 25936802, 29750193
GO:0005764	Component	Lysosome	IMP	22424946
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005765	Component	Lysosomal membrane	IDA	30956113
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005979	Process	Regulation of glycogen biosynthetic process	IEA
GO:0006112	Process	Energy reserve metabolic process	IEA
GO:0006207	Process	'de novo' pyrimidine nucleobase biosynthetic process	IEA
GO:0006468	Process	Protein phosphorylation	IDA	12150926, 15467718, 18925875
GO:0006468	Process	Protein phosphorylation	IMP	17028174
GO:0007040	Process	Lysosome organization	IDA	22692423
GO:0007050	Process	Cell cycle arrest	TAS
GO:0007281	Process	Germ cell development	IEA
GO:0007420	Process	Brain development	IEA
GO:0007569	Process	Cell aging	IEA
GO:0007584	Process	Response to nutrient	IMP	17028174
GO:0007616	Process	Long-term memory	IEA
GO:0008361	Process	Regulation of cell size	IMP	22424946
GO:0008542	Process	Visual learning	IEA
GO:0009267	Process	Cellular response to starvation	IDA	22343943, 22576015, 22692423, 28223137
GO:0009791	Process	Post-embryonic development	IEA
GO:0010507	Process	Negative regulation of autophagy	IDA	22576015, 30704899
GO:0010507	Process	Negative regulation of autophagy	IMP	22424946
GO:0010507	Process	Negative regulation of autophagy	ISS
GO:0010592	Process	Positive regulation of lamellipodium assembly	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	17028174
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	27919618
GO:0010831	Process	Positive regulation of myotube differentiation	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0012505	Component	Endomembrane system	IDA	18497260, 22424946
GO:0014042	Process	Positive regulation of neuron maturation	IEA
GO:0014736	Process	Negative regulation of muscle atrophy	IEA
GO:0014823	Process	Response to activity	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	11853878
GO:0016241	Process	Regulation of macroautophagy	TAS
GO:0016242	Process	Negative regulation of macroautophagy	IBA	21873635
GO:0016242	Process	Negative regulation of macroautophagy	IDA	25327288
GO:0016301	Function	Kinase activity	IDA	15467718, 25327288
GO:0016301	Function	Kinase activity	TAS	11853878
GO:0016310	Process	Phosphorylation	IDA	11853878, 25327288
GO:0016605	Component	PML body	ISS
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	22343943, 22576015, 22692423
GO:0018105	Process	Peptidyl-serine phosphorylation	IMP	20537536, 23728790
GO:0018105	Process	Peptidyl-serine phosphorylation	ISS
GO:0018107	Process	Peptidyl-threonine phosphorylation	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0021510	Process	Spinal cord development	IEA
GO:0030163	Process	Protein catabolic process	TAS	11853878
GO:0030425	Component	Dendrite	IEA
GO:0030838	Process	Positive regulation of actin filament polymerization	IEA
GO:0031397	Process	Negative regulation of protein ubiquitination	IEA
GO:0031529	Process	Ruffle organization	IEA
GO:0031641	Process	Regulation of myelination	IEA
GO:0031667	Process	Response to nutrient levels	IDA	29750193
GO:0031669	Process	Cellular response to nutrient levels	ISS
GO:0031929	Process	TOR signaling	IMP	15467718, 17028174, 18762023, 26018084, 29750193
GO:0031929	Process	TOR signaling	NAS	23778976
GO:0031931	Component	TORC1 complex	IBA	21873635
GO:0031931	Component	TORC1 complex	IDA	12150926, 12718876, 15467718, 18925875
GO:0031931	Component	TORC1 complex	IMP	20537536
GO:0031932	Component	TORC2 complex	IBA	21873635
GO:0031932	Component	TORC2 complex	IDA	15467718, 18925875
GO:0031998	Process	Regulation of fatty acid beta-oxidation	IEA
GO:0032095	Process	Regulation of response to food	IEA
GO:0032148	Process	Activation of protein kinase B activity	TAS
GO:0032516	Process	Positive regulation of phosphoprotein phosphatase activity	TAS	28386764
GO:0032868	Process	Response to insulin	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	15467718
GO:0034198	Process	Cellular response to amino acid starvation	IDA	22343943, 22424946, 22576015, 22692423
GO:0035176	Process	Social behavior	IEA
GO:0035264	Process	Multicellular organism growth	IEA
GO:0038202	Process	TORC1 signaling	IBA	21873635
GO:0038202	Process	TORC1 signaling	IDA	28223137
GO:0038202	Process	TORC1 signaling	IMP	12718876, 22424946
GO:0042060	Process	Wound healing	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042802	Function	Identical protein binding	IPI	11438723, 24670654
GO:0043022	Function	Ribosome binding	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043087	Process	Regulation of GTPase activity	IEA
GO:0043200	Process	Response to amino acid	IDA	18497260
GO:0043276	Process	Anoikis	NAS	23778976
GO:0043278	Process	Response to morphine	IEA
GO:0043610	Process	Regulation of carbohydrate utilization	IEA
GO:0045182	Function	Translation regulator activity	IEA
GO:0045335	Component	Phagocytic vesicle	IDA	27623384
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0045670	Process	Regulation of osteoclast differentiation	ISS
GO:0045727	Process	Positive regulation of translation	IDA	18762023
GO:0045792	Process	Negative regulation of cell size	IEA
GO:0045945	Process	Positive regulation of transcription by RNA polymerase III	IMP	20233713
GO:0046777	Process	Protein autophosphorylation	IDA	15467718
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IMP	18762023
GO:0048255	Process	MRNA stabilization	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IEA
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IEA
GO:0050882	Process	Voluntary musculoskeletal movement	IEA
GO:0051219	Function	Phosphoprotein binding	IPI	11853878
GO:0051496	Process	Positive regulation of stress fiber assembly	IEA
GO:0051549	Process	Positive regulation of keratinocyte migration	IMP	27919618
GO:0051647	Process	Nucleus localization	IDA	22343943, 22576015, 22692423
GO:0051897	Process	Positive regulation of protein kinase B signaling	IEA
GO:0055013	Process	Cardiac muscle cell development	IEA
GO:0060048	Process	Cardiac muscle contraction	IEA
GO:0060135	Process	Maternal process involved in female pregnancy	IEA
GO:0060252	Process	Positive regulation of glial cell proliferation	IEA
GO:0060999	Process	Positive regulation of dendritic spine development	IEA
GO:0061051	Process	Positive regulation of cell growth involved in cardiac muscle cell development	IEA
GO:0070885	Process	Negative regulation of calcineurin-NFAT signaling cascade	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	IDA	22424946
GO:0071233	Process	Cellular response to leucine	IDA	22424946
GO:0071456	Process	Cellular response to hypoxia	ISS
GO:0090335	Process	Regulation of brown fat cell differentiation	IEA
GO:0090559	Process	Regulation of membrane permeability	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099524	Component	Postsynaptic cytosol	IEA
GO:0099547	Process	Regulation of translation at synapse, modulating synaptic transmission	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA
GO:1900034	Process	Regulation of cellular response to heat	TAS
GO:1901216	Process	Positive regulation of neuron death	IEA
GO:1901838	Process	Positive regulation of transcription of nucleolar large rRNA by RNA polymerase I	IMP	24036451
GO:1903691	Process	Positive regulation of wound healing, spreading of epidermal cells	IMP	27919618
GO:1904000	Process	Positive regulation of eating behavior	IEA
GO:1904056	Process	Positive regulation of cholangiocyte proliferation	IEA
GO:1904058	Process	Positive regulation of sensory perception of pain	IEA
GO:1904059	Process	Regulation of locomotor rhythm	ISS
GO:1904193	Process	Negative regulation of cholangiocyte apoptotic process	IEA
GO:1904197	Process	Positive regulation of granulosa cell proliferation	IEA
GO:1904206	Process	Positive regulation of skeletal muscle hypertrophy	IEA
GO:1904213	Process	Negative regulation of iodide transmembrane transport	IEA
GO:1904690	Process	Positive regulation of cytoplasmic translational initiation	TAS	28386764
GO:1990253	Process	Cellular response to leucine starvation	IDA	22424946

Other IDs

• MIM: 601231
• HGNC: 3942
• e!Ensembl: ENSG00000198793

Protein

• UniProt ID: P42345
• Protein name: Serine/threonine-protein kinase mTOR (EC 2.7.11.1) (FK506-binding protein 12-rapamycin complex-associated protein 1) (FKBP12-rapamycin complex-associated protein) (Mammalian target of rapamycin) (mTOR) (Mechanistic target of rapamycin) (Rapamycin and FKBP
• Protein function: Serine/threonine protein kinase which is a central regulator of cellular metabolism, growth and survival in response to hormones, growth factors, nutrients, energy and stress signals (PubMed:12087098, PubMed:12150925, PubMed:12150926, PubMed:122
• PDB: 1AUE, 1FAP, 1NSG, 2FAP, 2GAQ, 2NPU, 2RSE, 3FAP, 3JBZ, 4DRH, 4DRI, 4DRJ, 4FAP, 4JSN, 4JSP, 4JSV, 4JSX, 4JT5, 4JT6, 5FLC, 5GPG, 5H64, 5WBH, 5WBU, 5WBY, 5ZCS, 6BCU, 6BCX, 6M4U, 6M4W, 6SB0, 6SB2, 6ZWM, 6ZWO, 7EPD, 7OWG, 7PE7, 7PE8, 7PE9, 7PEA, 7PEB, 7PEC, 7TZO, 7UXC, 7UXH, 8ER6, 8ER7, 8ERA, 8PPZ, 8RCH, 8RCK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11865	DUF3385	854 → 1024	Domain of unknown function (DUF3385)	Family
  PF02259	FAT	1513 → 1908	FAT domain	Family
  PF08771	FRB_dom	2015 → 2113	FKBP12-rapamycin binding domain	Domain
  PF00454	PI3_PI4_kinase	2181 → 2431	Phosphatidylinositol 3- and 4-kinase	Family
  PF02260	FATC	2518 → 2549	FATC domain	Family

• Sequence:

  MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
  TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
  VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
  TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
  AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
  KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTLVESR
  CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
  LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
  TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
  KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
  QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
  VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
  MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
  LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
  LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
  VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
  DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
  SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
  VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
  RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
  RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
  STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
  AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
  VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
  GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
  WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
  QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
  ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
  PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
  QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
  VLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSP
  TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
  EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
  KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
  ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
  WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
  QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
  SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
  MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
  PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
  HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
  VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
  VPTQVELLIKQATSHENLCQCYIGWCPFW

• Sequence length: 2549