MET (MET proto-oncogene, receptor tyrosine kinase)

Gene

• Entrez ID: 4233
• Gene name: MET proto-oncogene, receptor tyrosine kinase
• Gene symbol: MET
• Synonyms: AUTS9, DFNB97, HGFR, RCCP2, c-Met
• Chromosome: 7
• Chromosome location: 7q31.2
• Summary: This gene encodes a member of the receptor tyrosine kinase family of proteins and the product of the proto-oncogene MET. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that are linked via disulfide bonds to form the mature receptor. Further processing of the beta subunit results in the formation of the M10 peptide, which has been shown to reduce lung fibrosis. Binding of its ligand, hepatocyte growth factor, induces dimerization and activation of the receptor, which plays a role in cellular survival, embryogenesis, and cellular migration and invasion. Mutations in this gene are associated with papillary renal cell carcinoma, hepatocellular carcinoma, and various head and neck cancers. Amplification and overexpression of this gene are also associated with multiple human cancers. [provided by RefSeq, May 2016]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs34589476	C>T	Likely-pathogenic, conflicting-interpretations-of-pathogenicity, likely-benign	Non coding transcript variant, missense variant, genic downstream transcript variant, coding sequence variant
rs35776110	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign, benign-likely-benign	Non coding transcript variant, genic upstream transcript variant, missense variant, intron variant, coding sequence variant
rs45520237	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign	Non coding transcript variant, synonymous variant, coding sequence variant
rs56311081	C>A,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Non coding transcript variant, stop gained, genic upstream transcript variant, missense variant, intron variant, coding sequence variant
rs56391007	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity, likely-pathogenic, benign-likely-benign	Non coding transcript variant, missense variant, genic downstream transcript variant, coding sequence variant
rs121913243	A>C,G	Pathogenic, likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913244	C>T	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913245	T>C	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913246	A>G	Pathogenic, likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913247	T>C	Uncertain-significance, likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913668	T>C	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913669	G>A,T	Uncertain-significance, pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913670	G>A	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913671	G>A,C	Pathogenic, likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913673	C>G,T	Uncertain-significance, pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913675	C>T	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913676	G>A,C,T	Pathogenic, likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913677	A>G	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs180985111	G>A	Not-provided, conflicting-interpretations-of-pathogenicity, likely-benign	Non coding transcript variant, intron variant, missense variant, coding sequence variant, genic upstream transcript variant
rs200074800	G>A,T	Not-provided, conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant, non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs200740468	G>A,C	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, coding sequence variant, non coding transcript variant
rs200861145	T>A	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant, non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs201274041	G>A,T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Intron variant, non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs398123568	C>G	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Non coding transcript variant, missense variant, coding sequence variant
rs398123569	C>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Non coding transcript variant, genic downstream transcript variant, missense variant, coding sequence variant
rs398123570	G>C	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Non coding transcript variant, genic downstream transcript variant, missense variant, coding sequence variant
rs587780736	C>-,CC	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant
rs772860611	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, genic downstream transcript variant, non coding transcript variant, synonymous variant
rs776014448	A>G	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, genic upstream transcript variant, intron variant, non coding transcript variant, missense variant
rs786202724	G>A	Pathogenic, likely-pathogenic	Coding sequence variant, non coding transcript variant, genic downstream transcript variant, missense variant
rs794728016	T>G	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs869320706	GAGCTACTTTTCCAGAAGGTATATTTC>-	Risk-factor	Intron variant, genic downstream transcript variant, splice donor variant, coding sequence variant, non coding transcript variant
rs869320707	G>T	Risk-factor	Genic downstream transcript variant, splice donor variant
rs1057519824	T>G	Likely-pathogenic	Non coding transcript variant, genic downstream transcript variant, coding sequence variant, missense variant
rs1057520030	A>G,T	Likely-pathogenic	Non coding transcript variant, genic downstream transcript variant, coding sequence variant, missense variant
rs1554400286	A>G	Risk-factor	Genic downstream transcript variant, coding sequence variant, missense variant, non coding transcript variant
rs1584941533	T>C	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant, non coding transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000185	hsa-miR-206	Western blot	19620785
MIRT000185	hsa-miR-206	Luciferase reporter assay, Western blot	19710019
MIRT000185	hsa-miR-206	qRT-PCR, ChIP, Luciferase reporter assay, Western blot, Northern blot	20388878
MIRT000185	hsa-miR-206	FACS, Flow, Immunohistochemistry, qRT-PCR, Western blot	26186594
MIRT000757	hsa-miR-34c-5p	Luciferase reporter assay	19461653
MIRT000757	hsa-miR-34c-5p	Luciferase reporter assay	20198305
MIRT000757	hsa-miR-34c-5p	Microarray, Western blot, RTPCR	20924086
MIRT000757	hsa-miR-34c-5p	Luciferase reporter assay	22419847
MIRT000757	hsa-miR-34c-5p	Luciferase reporter assay	23922103
MIRT000757	hsa-miR-34c-5p	Next Generation Sequencing (NGS), qRT-PCR, Western blot	26795575
MIRT000758	hsa-miR-34b-5p	Luciferase reporter assay	19461653
MIRT000759	hsa-miR-34a-5p	Luciferase reporter assay	19461653
MIRT000759	hsa-miR-34a-5p	Luciferase reporter assay	18834857
MIRT000759	hsa-miR-34a-5p	qRT-PCR, Western blot	19006648
MIRT000759	hsa-miR-34a-5p	Luciferase reporter assay, Western blot, Northern blot	19029026
MIRT000759	hsa-miR-34a-5p	qRT-PCR, Western blot	20309880
MIRT000759	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	19773441
MIRT000759	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22457788
MIRT000759	hsa-miR-34a-5p	Luciferase reporter assay	22159222
MIRT000759	hsa-miR-34a-5p	qRT-PCR	21240262
MIRT000759	hsa-miR-34a-5p	Immunofluorescence, qRT-PCR, Western blot	23970470
MIRT000759	hsa-miR-34a-5p	ELISA, Luciferase reporter assay, qRT-PCR	24983493
MIRT000759	hsa-miR-34a-5p	Flow, Immunofluorescence, In situ hybridization, qRT-PCR, Western blot	26313360
MIRT000759	hsa-miR-34a-5p	Immunohistochemistry, qRT-PCR, Western blot	26238271
MIRT000759	hsa-miR-34a-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	27513895
MIRT000759	hsa-miR-34a-5p	Immunoblot, qRT-PCR	28250026
MIRT001357	hsa-miR-1-3p	Luciferase reporter assay, Western blot	19710019
MIRT001357	hsa-miR-1-3p	Luciferase reporter assay, Western blot	18818206
MIRT001357	hsa-miR-1-3p	Luciferase reporter assay, Western blot	18593903
MIRT001357	hsa-miR-1-3p	pSILAC, Proteomics	18668040
MIRT001357	hsa-miR-1-3p	qRT-PCR	21169019
MIRT001357	hsa-miR-1-3p	Microarray	18668037
MIRT001357	hsa-miR-1-3p	Microarray, qRT-PCR, Western blot	25874496
MIRT001357	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	27247259
MIRT001969	hsa-miR-199a-3p	Luciferase reporter assay, Western blot	18456660
MIRT001969	hsa-miR-199a-3p	Immunofluorescence, Microarray, QRTPCRWestern blot	24810336
MIRT001969	hsa-miR-199a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26051997
MIRT001969	hsa-miR-199a-3p	Luciferase reporter assay	25839163
MIRT004292	hsa-miR-23b-3p	Luciferase reporter assay, qRT-PCR, Western blot, Reporter assay;Western blot;qRT-PCR	19490101
MIRT004292	hsa-miR-23b-3p	qRT-PCR, Luciferase reporter assay, Western blot	25405368
MIRT004292	hsa-miR-23b-3p	Luciferase reporter assay, qRT-PCR, Western blot	28077801
MIRT004825	hsa-miR-34b-3p	Microarray, Western blot, RTPCR	20924086
MIRT004825	hsa-miR-34b-3p	Luciferase reporter assay	22419847
MIRT005024	hsa-miR-562	Luciferase reporter assay	19789318
MIRT005167	hsa-miR-30a-5p	pSILAC, Proteomics;Other	18668040
MIRT005458	hsa-miR-340-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	21692045
MIRT006346	hsa-miR-449a	Luciferase reporter assay, Western blot	21418558
MIRT006346	hsa-miR-449a	Luciferase reporter assay, Western Blot, qRT-PCR	23734217
MIRT006346	hsa-miR-449a	Luciferase reporter assay, qRT-PCR, Western blot	26471185
MIRT006351	hsa-miR-449b-5p	Luciferase reporter assay, Western blot	21418558
MIRT006778	hsa-miR-198	Luciferase reporter assay, qRT-PCR, Western blot	21658389
MIRT007137	hsa-miR-130a-3p	qRT-PCR	23418453
MIRT016691	hsa-miR-133b	Reporter assay	20505319
MIRT016691	hsa-miR-133b	Western blot	24391788
MIRT035528	hsa-miR-31-5p	Luciferase reporter assay	23552883
MIRT035528	hsa-miR-31-5p	Luciferase reporter assay	23553486
MIRT035528	hsa-miR-31-5p	Immunoblot, Immunohistochemistry, Luciferase reporter assay, qRT-PCR	22948084
MIRT035879	hsa-miR-1303	CLASH	23622248
MIRT044529	hsa-miR-320a	CLASH	23622248
MIRT053148	hsa-miR-27a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23650389
MIRT053225	hsa-miR-137	Luciferase reporter assay, qRT-PCR, Western blot	23151846
MIRT054232	hsa-miR-410-3p	Luciferase reporter assay, qRT-PCR, Western blot	22750473
MIRT054388	hsa-miR-148a-3p	Immunoblot, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24013226
MIRT319319	hsa-miR-449c-5p	Luciferase reporter assay, qRT-PCR, Western blot	26141986
MIRT437442	hsa-miR-409-3p	Luciferase reporter assay, qRT-PCR, Western blot	23820886
MIRT437858	hsa-miR-101-3p	Luciferase reporter assay, Western blot	23618864
MIRT438343	hsa-miR-144-3p	ChIP-seq, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25927670
MIRT438343	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR, Western blot	26250785
MIRT438442	hsa-miR-7515	Luciferase reporter assay, qRT-PCR, Western blot	23087254
MIRT440251	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT731338	hsa-miR-433-3p	Luciferase reporter assay	26844702
MIRT732083	hsa-miR-139-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	26497851
MIRT732479	hsa-miR-27b-3p	qRT-PCR, Luciferase reporter assay, Western blot	25405368
MIRT733070	hsa-miR-34a-3p	Western blot	27364974
MIRT734958	hsa-miR-1-5p	Luciferase reporter assay	27169691
MIRT735298	hsa-miR-144-5p	Luciferase reporter assay, qRT-PCR, Western blot	25961751
MIRT790064	hsa-miR-1257	HITS-CLIP	28735896
MIRT790069	hsa-miR-1262	HITS-CLIP	28735896
MIRT790393	hsa-miR-425-5p	HITS-CLIP	28735896
MIRT790503	hsa-miR-4506	HITS-CLIP	28735896
MIRT790571	hsa-miR-4701-3p	HITS-CLIP	28735896
MIRT790733	hsa-miR-545-5p	HITS-CLIP	28735896
MIRT790905	hsa-miR-6736-5p	HITS-CLIP	28735896
MIRT791134	hsa-miR-802	HITS-CLIP	28735896

Transcription factors

Transcription factor	Regulation	Reference
FOXP2	Repression	21832174
HIF1A	Activation	16099863
MITF	Unknown	17371876
PAX3	Unknown	8633043
PAX5	Activation	24628993
PAX5	Unknown	19139719
PAX6	Activation	19651775
SMAD7	Activation	15339794
SP1	Activation	11910354;21831840
SP1	Repression	21831840
TP53	Repression	21831840
YBX1	Activation	19648825

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0001886	Process	Endothelial cell morphogenesis	IDA	14500721
GO:0001889	Process	Liver development	IBA	21873635
GO:0004713	Function	Protein tyrosine kinase activity	NAS	3325883
GO:0004713	Function	Protein tyrosine kinase activity	TAS
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IBA	21873635
GO:0005008	Function	Hepatocyte growth factor-activated receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	1846706, 11571281, 11590178, 12475979, 15167892, 15184888, 16101282, 16537444, 16537482, 17662939, 17804794, 17981115, 18273061, 18579758, 19167335, 20624308, 20624990, 20802513, 21163258, 21242965, 22404908, 22789536, 22897854, 22962849, 23866081, 24034250, 24189400, 24728074, 2524
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0006909	Process	Phagocytosis	IBA	21873635
GO:0007165	Process	Signal transduction	TAS	1846706
GO:0007166	Process	Cell surface receptor signaling pathway	NAS	2819873
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IBA	21873635
GO:0007275	Process	Multicellular organism development	IBA	21873635
GO:0007399	Process	Nervous system development	IBA	21873635
GO:0009925	Component	Basal plasma membrane	IBA	21873635
GO:0009925	Component	Basal plasma membrane	IDA	15314156
GO:0009986	Component	Cell surface	HDA	19581412
GO:0010507	Process	Negative regulation of autophagy	NAS	24743740
GO:0016021	Component	Integral component of membrane	NAS	2819873
GO:0016477	Process	Cell migration	IBA	21873635
GO:0017154	Function	Semaphorin receptor activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IEA
GO:0019903	Function	Protein phosphatase binding	IPI	18819921
GO:0030182	Process	Neuron differentiation	IBA	21873635
GO:0031016	Process	Pancreas development	IBA	21873635
GO:0031116	Process	Positive regulation of microtubule polymerization	IMP	25198505
GO:0033674	Process	Positive regulation of kinase activity	IBA	21873635
GO:0035024	Process	Negative regulation of Rho protein signal transduction	IDA	25198505
GO:0035635	Process	Entry of bacterium into host cell	TAS
GO:0042802	Function	Identical protein binding	IPI	16537482, 20624990
GO:0043235	Component	Receptor complex	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	22521434
GO:0048012	Process	Hepatocyte growth factor receptor signaling pathway	IEA
GO:0048754	Process	Branching morphogenesis of an epithelial tube	IMP	16153003
GO:0050918	Process	Positive chemotaxis	IDA	15218527
GO:0051497	Process	Negative regulation of stress fiber assembly	IDA	25198505
GO:0051897	Process	Positive regulation of protein kinase B signaling	IBA	21873635
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0061436	Process	Establishment of skin barrier	IMP	25198505
GO:0070495	Process	Negative regulation of thrombin-activated receptor signaling pathway	IDA	25198505
GO:0071526	Process	Semaphorin-plexin signaling pathway	IDA	15218527
GO:1901299	Process	Negative regulation of hydrogen peroxide-mediated programmed cell death	IMP	20655899
GO:1905098	Process	Negative regulation of guanyl-nucleotide exchange factor activity	IDA	25198505
GO:2001028	Process	Positive regulation of endothelial cell chemotaxis	IMP	19850054

Other IDs

• MIM: 164860
• HGNC: 7029
• e!Ensembl: ENSG00000105976

Protein

• UniProt ID: P08581
• Protein name: Hepatocyte growth factor receptor (HGF receptor) (EC 2.7.10.1) (HGF/SF receptor) (Proto-oncogene c-Met) (Scatter factor receptor) (SF receptor) (Tyrosine-protein kinase Met)
• Protein function: Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to hepatocyte growth factor/HGF ligand. Regulates many physiological processes including proliferation, scattering, morphogenesis and survival. Ligand binding at the cell surface induces autophosphorylation of MET on its intracellular domain that provides docking sites for downstream signaling molecules. Following activation by ligand, interacts with the PI3-kinase subunit PIK3R1, PLCG1, SRC, GRB2, STAT3 or the adapter GAB1. Recruitment of these downstream effectors by MET leads to the activation of several signaling cascades including the RAS-ERK, PI3 kinase-AKT, or PLCgamma-PKC. The RAS-ERK activation is associated with the morphogenetic effects while PI3K/AKT coordinates prosurvival effects. During embryonic development, MET signaling plays a role in gastrulation, development and migration of muscles and neuronal precursors, angiogenesis and kidney formation. In adults, participates in wound healing as well as organ regeneration and tissue remodeling. Promotes also differentiation and proliferation of hematopoietic cells. May regulate cortical bone osteogenesis (By similarity). ; (Microbial infection) Acts as a receptor for Listeria monocytogenes internalin InlB, mediating entry of the pathogen into cells.
• PDB: 1FYR, 1R0P, 1R1W, 1SHY, 1SSL, 1UX3, 2G15, 2RFN, 2RFS, 2UZX, 2UZY, 2WD1, 2WGJ, 2WKM, 3A4P, 3BUX, 3C1X, 3CCN, 3CD8, 3CE3, 3CTH, 3CTJ, 3DKC, 3DKF, 3DKG, 3EFJ, 3EFK, 3F66, 3F82, 3I5N, 3L8V, 3LQ8, 3Q6U, 3Q6W, 3QTI, 3R7O, 3RHK, 3U6H, 3U6I, 3VW8, 3ZBX, 3ZC5, 3ZCL, 3ZXZ, 3ZZE, 4AOI, 4AP7, 4DEG, 4DEH, 4DEI, 4EEV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01403	Sema	54 → 493	Sema domain	Family
  PF01437	PSI	519 → 562	Plexin repeat	Family
  PF01833	TIG	563 → 654	IPT/TIG domain	Domain
  PF01833	TIG	657 → 738	IPT/TIG domain	Domain
  PF01833	TIG	742 → 832	IPT/TIG domain	Domain
  PF07714	PK_Tyr_Ser-Thr	1078 → 1337	Protein tyrosine and serine/threonine kinase	Domain

• Sequence:

  MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEH
  HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL
  VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSAL
  GAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE
  FRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL
  TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS
  AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF
  TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL
  LDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW
  CHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKK
  TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVIT
  SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF
  AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVPRMVINVH
  EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV
  FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL
  LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQ
  IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS
  CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
  NEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
  SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
  VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
  TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
  HPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVD
  TRPASFWETS

• Sequence length: 1390