MAPK13 (mitogen-activated protein kinase 13)

Gene

• Entrez ID: 5603
• Gene name: Mitogen-activated protein kinase 13
• Gene symbol: MAPK13
• Synonyms: MAPK 13, MAPK-13, PRKM13, SAPK4, p38delta
• Chromosome: 6
• Chromosome location: 6p21.31
• Summary: This gene encodes a member of the mitogen-activated protein (MAP) kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The encoded protein is a p38 MAP kinase and is activated by proinflammatory cytokines and cellular stress. Substrates of the encoded protein include the transcription factor ATF2 and the microtubule dynamics regulator stathmin. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT462701	hsa-miR-3691-5p	PAR-CLIP	23592263
MIRT462702	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT462703	hsa-miR-4531	PAR-CLIP	23592263
MIRT462704	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT462705	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT462706	hsa-miR-4525	PAR-CLIP	23592263
MIRT462707	hsa-miR-5187-5p	PAR-CLIP	23592263
MIRT462708	hsa-miR-5703	PAR-CLIP	23592263
MIRT462709	hsa-miR-4516	PAR-CLIP	23592263
MIRT462710	hsa-miR-4434	PAR-CLIP	23592263
MIRT462711	hsa-miR-8082	PAR-CLIP	23592263
MIRT462712	hsa-miR-3134	PAR-CLIP	23592263
MIRT462713	hsa-miR-4534	PAR-CLIP	23592263
MIRT462714	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT462715	hsa-miR-5685	PAR-CLIP	23592263
MIRT462716	hsa-miR-4690-3p	PAR-CLIP	23592263
MIRT462717	hsa-miR-4773	PAR-CLIP	23592263
MIRT519494	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT519495	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT519496	hsa-miR-6778-3p	PAR-CLIP	23446348
MIRT519497	hsa-miR-150-5p	PAR-CLIP	23446348
MIRT519498	hsa-miR-6814-5p	PAR-CLIP	23446348
MIRT519499	hsa-miR-4735-3p	PAR-CLIP	23446348
MIRT519500	hsa-miR-4761-5p	PAR-CLIP	23446348
MIRT519501	hsa-miR-18b-5p	PAR-CLIP	23446348
MIRT519502	hsa-miR-18a-5p	PAR-CLIP	23446348
MIRT732510	hsa-miR-155-5p	Luciferase reporter assay	25535908

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	12244047, 15850461
GO:0004707	Function	MAP kinase activity	IBA	21873635
GO:0004707	Function	MAP kinase activity	IDA	9218798, 9731215
GO:0005515	Function	Protein binding	IPI	19135240, 22447027
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006970	Process	Response to osmotic stress	IDA	9731215
GO:0007049	Process	Cell cycle	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	15850461
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	19279008
GO:0034644	Process	Cellular response to UV	IDA	9218798
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0050729	Process	Positive regulation of inflammatory response	IC	19279008
GO:0051403	Process	Stress-activated MAPK cascade	IDA	9218798
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	9218798
GO:0071347	Process	Cellular response to interleukin-1	IDA	9218798
GO:0072709	Process	Cellular response to sorbitol	IDA	9218798
GO:0072740	Process	Cellular response to anisomycin	IDA	9218798
GO:1903936	Process	Cellular response to sodium arsenite	IDA	9218798

Other IDs

• MIM: 602899
• HGNC: 6875
• e!Ensembl: ENSG00000156711

Protein

• UniProt ID: O15264
• Protein name: Mitogen-activated protein kinase 13 (MAP kinase 13) (MAPK 13) (EC 2.7.11.24) (Mitogen-activated protein kinase p38 delta) (MAP kinase p38 delta) (Stress-activated protein kinase 4)
• Protein function: Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK13 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors such as ELK1 and ATF2. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each. MAPK13 is one of the less studied p38 MAPK isoforms. Some of the targets are downstream kinases such as MAPKAPK2, which are activated through phosphorylation and further phosphorylate additional targets. Plays a role in the regulation of protein translation by phosphorylating and inactivating EEF2K. Involved in cytoskeletal remodeling through phosphorylation of MAPT and STMN1. Mediates UV irradiation induced up-regulation of the gene expression of CXCL14. Plays an important role in the regulation of epidermal keratinocyte differentiation, apoptosis and skin tumor development. Phosphorylates the transcriptional activator MYB in response to stress which leads to rapid MYB degradation via a proteasome-dependent pathway. MAPK13 also phosphorylates and down-regulates PRKD1 during regulation of insulin secretion in pancreatic beta cells.
• PDB: 3COI, 4EYJ, 4EYM, 4MYG, 4YNO, 5EKN, 5EKO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	25 → 308	Protein kinase domain	Domain

• Sequence:

  MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
  QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGM
  EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
  GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
  VPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA
  QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
  SGMKL

• Sequence length: 365