MAP2K6 (mitogen-activated protein kinase kinase 6)

Gene

• Entrez ID: 5608
• Gene name: Mitogen-activated protein kinase kinase 6
• Gene symbol: MAP2K6
• Synonyms: CRCMSL, MAPKK6, MEK6, MKK6, PRKMK6, SAPKK-3, SAPKK3
• Chromosome: 17
• Chromosome location: 17q24.3
• Summary: This gene encodes a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multipl

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016670	hsa-miR-425-5p	Sequencing	20371350
MIRT021513	hsa-miR-145-5p	Reporter assay;Microarray	21351259
MIRT053745	hsa-miR-29b-3p	Microarray	22942087
MIRT720403	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT720402	hsa-miR-5587-5p	HITS-CLIP	19536157
MIRT573371	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT573370	hsa-miR-1324	PAR-CLIP	20371350
MIRT573369	hsa-miR-922	PAR-CLIP	20371350
MIRT573368	hsa-miR-6804-5p	PAR-CLIP	20371350
MIRT573367	hsa-miR-3166	PAR-CLIP	20371350
MIRT573366	hsa-miR-6834-5p	PAR-CLIP	20371350
MIRT573365	hsa-miR-1226-5p	PAR-CLIP	20371350
MIRT573364	hsa-miR-6734-5p	PAR-CLIP	20371350
MIRT573363	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT573362	hsa-miR-8055	PAR-CLIP	20371350
MIRT473850	hsa-miR-590-3p	PAR-CLIP	23592263
MIRT473845	hsa-miR-411-5p	PAR-CLIP	23592263
MIRT473849	hsa-miR-6872-3p	PAR-CLIP	23592263
MIRT473847	hsa-miR-4735-5p	PAR-CLIP	23592263
MIRT473848	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT473846	hsa-miR-4775	PAR-CLIP	23592263
MIRT473845	hsa-miR-411-5p	PAR-CLIP	23592263
MIRT473844	hsa-miR-3149	PAR-CLIP	23592263
MIRT732300	hsa-miR-625-3p	Luciferase reporter assay, qRT-PCR, Western blot	27526785
MIRT732300	hsa-miR-625-3p	Luciferase reporter assay, qRT-PCR, Western blot	27526785
MIRT732300	hsa-miR-625-3p	Luciferase reporter assay, qRT-PCR, Western blot	27526785
MIRT735799	hsa-miR-10a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33128541
MIRT720403	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT720402	hsa-miR-5587-5p	HITS-CLIP	19536157
MIRT573371	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT573370	hsa-miR-1324	PAR-CLIP	20371350
MIRT573369	hsa-miR-922	PAR-CLIP	20371350
MIRT573368	hsa-miR-6804-5p	PAR-CLIP	20371350
MIRT573367	hsa-miR-3166	PAR-CLIP	20371350
MIRT573366	hsa-miR-6834-5p	PAR-CLIP	20371350
MIRT573365	hsa-miR-1226-5p	PAR-CLIP	20371350
MIRT573364	hsa-miR-6734-5p	PAR-CLIP	20371350
MIRT573363	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT573362	hsa-miR-8055	PAR-CLIP	20371350
MIRT473850	hsa-miR-590-3p	PAR-CLIP	23592263
MIRT473845	hsa-miR-411-5p	PAR-CLIP	23592263
MIRT473849	hsa-miR-6872-3p	PAR-CLIP	23592263
MIRT473847	hsa-miR-4735-5p	PAR-CLIP	23592263
MIRT473848	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT473846	hsa-miR-4775	PAR-CLIP	23592263
MIRT473845	hsa-miR-411-5p	PAR-CLIP	23592263
MIRT473844	hsa-miR-3149	PAR-CLIP	23592263
MIRT755867	hsa-miR-643	Luciferase reporter assay, Western blotting, qRT-PCR, In situ hybridization, RNA pull down assay	34581623
MIRT1920611	hsa-miR-34c-3p	CLIP-seq
MIRT1920612	hsa-miR-374a	CLIP-seq
MIRT1920613	hsa-miR-374b	CLIP-seq
MIRT1920611	hsa-miR-34c-3p	CLIP-seq
MIRT1920612	hsa-miR-374a	CLIP-seq
MIRT1920613	hsa-miR-374b	CLIP-seq
MIRT2266661	hsa-miR-4305	CLIP-seq
MIRT2266662	hsa-miR-664	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0000187	Process	Activation of MAPK activity	IBA	21873635
GO:0000187	Process	Activation of MAPK activity	IDA	8663524, 9218798
GO:0000187	Process	Activation of MAPK activity	TAS
GO:0002931	Process	Response to ischemia	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004708	Function	MAP kinase kinase activity	IBA	21873635
GO:0004708	Function	MAP kinase kinase activity	IDA	8663524, 9218798
GO:0004708	Function	MAP kinase kinase activity	TAS
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	11035004, 12052864, 15229216, 20067578, 25241761, 32296183, 32814053, 32911434
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006975	Process	DNA damage induced protein phosphorylation	TAS	10848581
GO:0007050	Process	Cell cycle arrest	TAS	10848581
GO:0007165	Process	Signal transduction	TAS	8621675
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IEA
GO:0019901	Function	Protein kinase binding	IPI	11279118
GO:0022602	Process	Ovulation cycle process	IEA
GO:0032308	Process	Positive regulation of prostaglandin secretion	IEA
GO:0042493	Process	Response to drug	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0051770	Process	Positive regulation of nitric-oxide synthase biosynthetic process	IEA
GO:0060048	Process	Cardiac muscle contraction	IEA
GO:0070423	Process	Nucleotide-binding oligomerization domain containing signaling pathway	TAS
GO:0072709	Process	Cellular response to sorbitol	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	29021624

Other IDs

• MIM: 601254
• HGNC: 6846
• e!Ensembl: ENSG00000108984

Protein

• UniProt ID: P52564
• Protein name: Dual specificity mitogen-activated protein kinase kinase 6 (MAP kinase kinase 6) (MAPKK 6) (EC 2.7.12.2) (MAPK/ERK kinase 6) (MEK 6) (Stress-activated protein kinase kinase 3) (SAPK kinase 3) (SAPKK-3) (SAPKK3)
• Protein function: Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. With MAP3K3/MKK3, catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11,
• PDB: 2Y8O, 3ENM, 3FME, 3VN9, 5ETF, 8A8M, 8P7J, 8PM3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	53 → 314	Protein kinase domain	Domain

• Sequence:

  MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
  RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
  REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
  KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
  WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK
  ERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

• Sequence length: 334