MAP2K3 (mitogen-activated protein kinase kinase 3)

Gene

• Entrez ID: 5606
• Gene name: Mitogen-activated protein kinase kinase 3
• Gene symbol: MAP2K3
• Synonyms: MAPKK3, MEK3, MKK3, PRKMK3, SAPKK-2, SAPKK2
• Chromosome: 17
• Chromosome location: 17p11.2
• Summary: The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. Multiple alternatively spliced transcript variants that encode distinct isoforms have been reported for this gene. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005426	hsa-miR-214-3p	GFP reporter assay, Microarray, qRT-PCR, Western blot, Reporter assay;qRT-PCR;Microarray;Other	19859982
MIRT005426	hsa-miR-214-3p	PAR-CLIP	26701625
MIRT006772	hsa-miR-20a-5p	Luciferase reporter assay	22696064
MIRT022960	hsa-miR-124-3p	Microarray	18668037
MIRT028553	hsa-miR-30a-5p	Proteomics	18668040
MIRT076343	hsa-miR-21-5p	Immunohistochemistry, Luciferase reporter assay, Western blot	24112539
MIRT144865	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT144866	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT440289	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT736169	hsa-miR-1227-5p	PAR-CLIP	26701625
MIRT736976	hsa-miR-128-1-5p	PAR-CLIP	26701625
MIRT736995	hsa-miR-128-2-5p	PAR-CLIP	26701625
MIRT737214	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT737941	hsa-miR-15a-5p	PAR-CLIP	26701625
MIRT737961	hsa-miR-15b-5p	PAR-CLIP	26701625
MIRT737987	hsa-miR-16-5p	PAR-CLIP	26701625
MIRT738630	hsa-miR-195-5p	PAR-CLIP	26701625
MIRT739482	hsa-miR-28-5p	PAR-CLIP	26701625
MIRT739499	hsa-miR-2861	PAR-CLIP	26701625
MIRT740169	hsa-miR-3139	PAR-CLIP	26701625
MIRT740353	hsa-miR-3151-5p	PAR-CLIP	26701625
MIRT741719	hsa-miR-3619-5p	PAR-CLIP	26701625
MIRT743304	hsa-miR-424-5p	PAR-CLIP	26701625
MIRT743575	hsa-miR-4270	PAR-CLIP	26701625
MIRT744542	hsa-miR-4441	PAR-CLIP	26701625
MIRT744731	hsa-miR-4456	PAR-CLIP	26701625
MIRT745106	hsa-miR-4481	PAR-CLIP	26701625
MIRT745679	hsa-miR-4512	PAR-CLIP	26701625
MIRT748154	hsa-miR-4743-5p	PAR-CLIP	26701625
MIRT748177	hsa-miR-4745-5p	PAR-CLIP	26701625
MIRT749285	hsa-miR-497-5p	PAR-CLIP	26701625
MIRT750377	hsa-miR-541-3p	PAR-CLIP	26701625
MIRT750902	hsa-miR-5571-3p	PAR-CLIP	26701625
MIRT751765	hsa-miR-6081	PAR-CLIP	26701625
MIRT753090	hsa-miR-6510-5p	PAR-CLIP	26701625
MIRT753448	hsa-miR-654-5p	PAR-CLIP	26701625
MIRT754014	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT754384	hsa-miR-6742-5p	PAR-CLIP	26701625
MIRT754717	hsa-miR-6754-5p	PAR-CLIP	26701625
MIRT754928	hsa-miR-6760-5p	PAR-CLIP	26701625
MIRT754985	hsa-miR-6762-5p	PAR-CLIP	26701625
MIRT755189	hsa-miR-6769a-5p	PAR-CLIP	26701625
MIRT755235	hsa-miR-6769b-5p	PAR-CLIP	26701625
MIRT755681	hsa-miR-6781-5p	PAR-CLIP	26701625
MIRT757286	hsa-miR-6838-5p	PAR-CLIP	26701625
MIRT757412	hsa-miR-6845-5p	PAR-CLIP	26701625
MIRT758184	hsa-miR-6877-5p	PAR-CLIP	26701625
MIRT758812	hsa-miR-708-5p	PAR-CLIP	26701625
MIRT759470	hsa-miR-761	PAR-CLIP	26701625
MIRT760218	hsa-miR-8085	PAR-CLIP	26701625
MIRT760565	hsa-miR-92a-2-5p	PAR-CLIP	26701625

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000187	Process	Activation of MAPK activity	IBA	21873635
GO:0000187	Process	Activation of MAPK activity	TAS
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004708	Function	MAP kinase kinase activity	IBA	21873635
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	11980910, 17255949, 19805025, 20067578, 20173330, 21044950, 21771788, 23602568, 31980649
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	TAS	7839144
GO:0016020	Component	Membrane	HDA	19946888
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IEA
GO:0019901	Function	Protein kinase binding	IPI	11279118
GO:0035331	Process	Negative regulation of hippo signaling	IMP	27402810
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IMP	22696064
GO:0038066	Process	P38MAPK cascade	IMP	22696064
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IMP	22696064
GO:0045860	Process	Positive regulation of protein kinase activity	IDA	11980910
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	11980910
GO:0060048	Process	Cardiac muscle contraction	IEA

Other IDs

• MIM: 602315
• HGNC: 6843
• e!Ensembl: ENSG00000034152

Protein

• UniProt ID: P46734
• Protein name: Dual specificity mitogen-activated protein kinase kinase 3 (MAP kinase kinase 3) (MAPKK 3) (EC 2.7.12.2) (MAPK/ERK kinase 3) (MEK 3) (Stress-activated protein kinase kinase 2) (SAPK kinase 2) (SAPKK-2) (SAPKK2)
• Protein function: Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38. Part of a signaling cascade that begins with the activation of the adrenergic receptor ADRA1B and leads to the activation of MAPK14.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	64 → 325	Protein kinase domain	Domain

• Sequence:

  MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVE
  ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
  FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
  HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
  NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
  FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

• Sequence length: 347