LBP (lipopolysaccharide binding protein)

Gene

• Entrez ID: 3929
• Gene name: Lipopolysaccharide binding protein
• Gene symbol: LBP
• Synonyms: BPIFD2
• Chromosome: 20
• Chromosome location: 20q11.23
• Summary: The protein encoded by this gene is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeab

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017289	hsa-miR-335-5p	Microarray	18185580
MIRT050450	hsa-miR-22-3p	CLASH	23622248
MIRT045133	hsa-miR-186-5p	CLASH	23622248
MIRT1105367	hsa-miR-4299	CLIP-seq
MIRT1105368	hsa-miR-4709-3p	CLIP-seq
MIRT1105369	hsa-miR-501-3p	CLIP-seq
MIRT1105370	hsa-miR-502-3p	CLIP-seq
MIRT1105371	hsa-miR-765	CLIP-seq
MIRT2560303	hsa-miR-1207-3p	CLIP-seq
MIRT2560304	hsa-miR-139-3p	CLIP-seq
MIRT2560305	hsa-miR-4267	CLIP-seq
MIRT2560306	hsa-miR-875-3p	CLIP-seq
MIRT2560303	hsa-miR-1207-3p	CLIP-seq
MIRT2560304	hsa-miR-139-3p	CLIP-seq
MIRT2683800	hsa-miR-3655	CLIP-seq
MIRT2560305	hsa-miR-4267	CLIP-seq
MIRT2683801	hsa-miR-578	CLIP-seq
MIRT2560306	hsa-miR-875-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
JUN	Repression	15114678

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IBA	21873635
GO:0001530	Function	Lipopolysaccharide binding	IDA	12594207
GO:0001530	Function	Lipopolysaccharide binding	IMP	24120359
GO:0001530	Function	Lipopolysaccharide binding	ISS	2477488
GO:0002224	Process	Toll-like receptor signaling pathway	TAS
GO:0002232	Process	Leukocyte chemotaxis involved in inflammatory response	IEA
GO:0002281	Process	Macrophage activation involved in immune response	IBA	21873635
GO:0002281	Process	Macrophage activation involved in immune response	IMP	24120359
GO:0002281	Process	Macrophage activation involved in immune response	ISS	2402637
GO:0005102	Function	Signaling receptor binding	ISS	2477488
GO:0005515	Function	Protein binding	IPI	15294986, 21988832, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	2402637, 11528597, 24120359
GO:0005615	Component	Extracellular space	ISS	2477488
GO:0006953	Process	Acute-phase response	IBA	21873635
GO:0006953	Process	Acute-phase response	IEP	12932360
GO:0006953	Process	Acute-phase response	ISS	2477488
GO:0006968	Process	Cellular defense response	ISS	2402637
GO:0008228	Process	Opsonization	IC	12932360
GO:0008228	Process	Opsonization	ISS	2477488
GO:0009986	Component	Cell surface	IDA	11528597
GO:0015920	Process	Lipopolysaccharide transport	IDA	8985160
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IBA	21873635
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IDA	8409400, 11739189
GO:0032490	Process	Detection of molecule of bacterial origin	IDA	11528597
GO:0032496	Process	Response to lipopolysaccharide	IDA	8409400, 11739189
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	11739189
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	8409400
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	8409400
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	8409400, 12594207
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	24120359
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS	2402637
GO:0033036	Process	Macromolecule localization	IDA	15294986
GO:0034142	Process	Toll-like receptor 4 signaling pathway	TAS
GO:0034145	Process	Positive regulation of toll-like receptor 4 signaling pathway	IDA	11528597
GO:0043032	Process	Positive regulation of macrophage activation	IBA	21873635
GO:0043032	Process	Positive regulation of macrophage activation	IDA	8409400
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045087	Process	Innate immune response	IC	12932360
GO:0045087	Process	Innate immune response	ISS	2477488
GO:0045919	Process	Positive regulation of cytolysis	IDA	15294986
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA	21873635
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	11528597
GO:0050829	Process	Defense response to Gram-negative bacterium	ISS	2402637
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA	21873635
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	12932360
GO:0060265	Process	Positive regulation of respiratory burst involved in inflammatory response	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070891	Function	Lipoteichoic acid binding	IDA	12594207
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	12594207
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	24120359
GO:0071223	Process	Cellular response to lipoteichoic acid	IDA	12594207
GO:0071723	Function	Lipopeptide binding	IDA	15294986
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA

Other IDs

• MIM: 151990
• HGNC: 6517
• e!Ensembl: ENSG00000129988

Protein

• UniProt ID: P18428
• Protein name: Lipopolysaccharide-binding protein (LBP)
• Protein function: Plays a role in the innate immune response. Binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria (PubMed:24120359, PubMed:7517398). Acts as an affinity enhan
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01273	LBP_BPI_CETP	38 → 212	LBP / BPI / CETP family, N-terminal domain	Family
  PF02886	LBP_BPI_CETP_C	241 → 478	LBP / BPI / CETP family, C-terminal domain	Domain

• Sequence:

  MGALARALPSILLALLLTSTPEALGANPGLVARITDKGLQYAAQEGLLALQSELLRITLP
  DFTGDLRIPHVGRGRYEFHSLNIHSCELLHSALRPVPGQGLSLSISDSSIRVQGRWKVRK
  SFFKLQGSFDVSVKGISISVNLLLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNL
  FHNQIESKFQKVLESRICEMIQKSVSSDLQPYLQTLPVTTEIDSFADIDYSLVEAPRATA
  QMLEVMFKGEIFHRNHRSPVTLLAAVMSLPEEHNKMVYFAISDYVFNTASLVYHEEGYLN
  FSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDP
  YMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFN
  AELLEALLNYYILNTFYPKFNDKLAEGFPLPLLKRVQLYDLGLQIHKDFLFLGANVQYMR
  V

• Sequence length: 481