GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

KRAS (KRAS proto-oncogene, GTPase)

Gene

KRAS proto-oncogene, GTPase

KRAS

'C-K-RAS, C-K-RAS, CFC2, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, K-Ras, K-Ras 2, KI-RAS, KRAS1, KRAS2, NS, NS3, OES, RALD, RASK2, c-Ki-ras, c-Ki-ras2

12p12.1

This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. [provided by RefSeq, Jul 2008]

Show/Hide all(46)

SNP ID	Visualize variation	Clinical significance	Consequence
rs17851045	T>A,G	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs104894359	C>G,T	Pathogenic	Coding sequence variant, missense variant
rs104894360	T>A,C	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant, 3 prime UTR variant
rs104894361	T>A,C,G	Pathogenic, uncertain-significance	Coding sequence variant, synonymous variant, missense variant
rs104894362	G>C	Pathogenic	Missense variant, coding sequence variant, 3 prime UTR variant
rs104894364	G>A	Pathogenic	Coding sequence variant, missense variant
rs104894365	C>T	Pathogenic, not-provided	Coding sequence variant, missense variant
rs104894366	G>A,C	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs104894367	A>C	Pathogenic	Missense variant, coding sequence variant, 3 prime UTR variant
rs112445441	C>A,G,T	Drug-response, pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs121913236	G>C,T	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs121913238	G>C,T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs121913240	T>A,C,G	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs121913527	C>A,G,T	Pathogenic, likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs121913528	C>A,T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs121913529	C>A,G,T	Not-provided, pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs121913530	C>A,G,T	Likely-pathogenic, pathogenic, not-provided, uncertain-significance	Coding sequence variant, missense variant
rs121913535	C>A,G,T	Pathogenic	Coding sequence variant, missense variant
rs121913538	C>A,G	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs193929331	T>C	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs201170656	T>G	Conflicting-interpretations-of-pathogenicity	Intron variant, missense variant, coding sequence variant
rs373169526	A>T	Conflicting-interpretations-of-pathogenicity	Intron variant, coding sequence variant, stop gained
rs387907205	A>C,G	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs387907206	T>C	Pathogenic, pathogenic-likely-pathogenic	Missense variant, coding sequence variant
rs397517040	G>A,T	Likely-pathogenic	Coding sequence variant, synonymous variant
rs397517041	C>A	Likely-pathogenic	Missense variant, 3 prime UTR variant, coding sequence variant
rs397517042	A>C,T	Likely-pathogenic, pathogenic	Missense variant, 3 prime UTR variant, coding sequence variant
rs397517476	A>G,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant, missense variant, coding sequence variant
rs606231202	->CCA	Pathogenic	Coding sequence variant, inframe insertion
rs727503106	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs727503108	C>A	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs727503109	T>C	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs727503110	T>A,C	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs727504662	T>A	Pathogenic	Coding sequence variant, missense variant
rs730880469	CTC>-	Likely-pathogenic	Coding sequence variant, inframe deletion
rs730880471	C>T	Likely-pathogenic, not-provided	Coding sequence variant, missense variant
rs730880472	A>C	Likely-pathogenic	Coding sequence variant, missense variant
rs770248150	T>A,G	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs1057519725	G>A	Not-provided, pathogenic	Missense variant, coding sequence variant
rs1064796748	->GCC	Pathogenic	Inframe indel, coding sequence variant
rs1135401776	T>C	Pathogenic	Missense variant, coding sequence variant
rs1555194026	C>A	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs1555195579	C>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1565878932	C>T	Pathogenic	3 prime UTR variant, missense variant, coding sequence variant
rs1592798693	T>A	Likely-pathogenic	Missense variant, intron variant, coding sequence variant
rs1592808357	C>A,G	Likely-pathogenic	Missense variant, coding sequence variant

Show/Hide all(104)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000230	hsa-miR-18a-3p	Luciferase reporter assay, qRT-PCR, Western blot	19372139
MIRT000312	hsa-miR-143-3p	qRT-PCR, Western blot	19157460
MIRT000312	hsa-miR-143-3p	Luciferase reporter assay, qRT-PCR, Microarray	19137007
MIRT000312	hsa-miR-143-3p	Western blot	23276710
MIRT000312	hsa-miR-143-3p	Luciferase reporter assay, qRT-PCR, Western blot	23128394
MIRT000399	hsa-let-7g-5p	Luciferase reporter assay	18308936
MIRT001855	hsa-let-7a-5p	Luciferase reporter assay, Microarray	15766527
MIRT001855	hsa-let-7a-5p	Western blot	20033209
MIRT001855	hsa-let-7a-5p	qRT-PCR, Western blot	16651716
MIRT001855	hsa-let-7a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25955298
MIRT003210	hsa-miR-181c-5p	Luciferase reporter assay, qRT-PCR, Western blot	20080834
MIRT003210	hsa-miR-181c-5p	qRT-PCR, Western blot	23667495
MIRT005100	hsa-miR-155-5p	Microarray	19193853
MIRT005100	hsa-miR-155-5p	pSILAC, Proteomics	18668040
MIRT005100	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT005100	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT005553	hsa-miR-96-5p	Immunoblot, Immunohistochemistry, Northern blot, Quantitative proteomic approach, Western blot, Reporter assay;Western blot;qRT-PCR;Other	20610624
MIRT005553	hsa-miR-96-5p	Sequencing	20371350
MIRT005553	hsa-miR-96-5p	Luciferase reporter assay, qRT-PCR, Western blot	23752186
MIRT005553	hsa-miR-96-5p	qRT-PCR, Western blot	25256312
MIRT006144	hsa-miR-216b-5p	Luciferase reporter assay, qRT-PCR, Western blot	21878506
MIRT006220	hsa-miR-622	Luciferase reporter assay, Western blot	22016468
MIRT006450	hsa-miR-126-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22384141
MIRT006501	hsa-miR-217	Luciferase reporter assay, Reporter assay	20675343
MIRT016516	hsa-miR-193b-3p	Microarray	20304954
MIRT016516	hsa-miR-193b-3p	PAR-CLIP	24398324
MIRT016516	hsa-miR-193b-3p	In situ hybridization, RTPCR, Luciferase reporter assay, Microarray, Western blot	24374827
MIRT016516	hsa-miR-193b-3p	Luciferase reporter assay, Western blot	25905463
MIRT025201	hsa-miR-181a-5p	Sequencing	20371350
MIRT025201	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23752186
MIRT025201	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27517749
MIRT053090	hsa-miR-16-5p	Luciferase reporter assay, Western blot	23507142
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, qRT-PCR, Western blot	23775631
MIRT053135	hsa-miR-134-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	24440911
MIRT053135	hsa-miR-134-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27830015
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, Western blot, qRT-PCR,	27012554
MIRT053521	hsa-miR-224-5p	qRT-PCR, Western blot	23667495
MIRT053523	hsa-miR-452-5p	qRT-PCR, Western blot	23667495
MIRT053524	hsa-miR-152-3p	qRT-PCR, Western blot	23667495
MIRT053525	hsa-miR-340-5p	qRT-PCR, Western blot	23667495
MIRT053561	hsa-miR-433-3p	Luciferase reporter assay, qRT-PCR, Western blot	23880861
MIRT437854	hsa-miR-487b-3p	ChIP-seq, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23426183
MIRT438022	hsa-miR-365a-3p	In situ hybridization, RTPCR, Luciferase reporter assay, Microarray, Western blot	24374827
MIRT438025	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT438025	hsa-miR-200c-3p	Luciferase reporter assay, Western blot, qRT-PCR	24368337
MIRT438025	hsa-miR-200c-3p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26392416
MIRT438156	hsa-miR-27a-3p	Luciferase reporter assay	24154848
MIRT438156	hsa-miR-27a-3p	qRT-PCR, Luciferase reporter assay, Western blot	25436011
MIRT438292	hsa-miR-206	Luciferase reporter assay, Western blot, qRT-PCR	25246801
MIRT438292	hsa-miR-206	Flow, qRT-PCR	24855559
MIRT438292	hsa-miR-206	Luciferase reporter assay, qRT-PCR, Immunohistochemistry, Western blot	25500542
MIRT502059	hsa-miR-4314	PAR-CLIP	24398324
MIRT502060	hsa-miR-6716-5p	PAR-CLIP	24398324
MIRT502061	hsa-miR-6866-5p	PAR-CLIP	24398324
MIRT502062	hsa-miR-3148	PAR-CLIP	24398324
MIRT502063	hsa-miR-6506-5p	PAR-CLIP	24398324
MIRT502064	hsa-miR-619-5p	PAR-CLIP	24398324
MIRT502065	hsa-miR-3192-5p	PAR-CLIP	24398324
MIRT502066	hsa-miR-4646-5p	PAR-CLIP	24398324
MIRT502067	hsa-miR-204-3p	PAR-CLIP	24398324
MIRT502068	hsa-miR-330-5p	PAR-CLIP	24398324
MIRT502069	hsa-miR-326	PAR-CLIP	24398324
MIRT502070	hsa-miR-6859-5p	PAR-CLIP	24398324
MIRT502071	hsa-miR-3916	PAR-CLIP	24398324
MIRT502072	hsa-miR-3125	PAR-CLIP	24398324
MIRT502073	hsa-miR-892b	PAR-CLIP	24398324
MIRT502074	hsa-miR-514a-5p	PAR-CLIP	24398324
MIRT502075	hsa-miR-5582-3p	PAR-CLIP	24398324
MIRT502076	hsa-miR-548x-3p	PAR-CLIP	24398324
MIRT502077	hsa-miR-548j-3p	PAR-CLIP	24398324
MIRT502078	hsa-miR-548aq-3p	PAR-CLIP	24398324
MIRT502079	hsa-miR-548am-3p	PAR-CLIP	24398324
MIRT502080	hsa-miR-548aj-3p	PAR-CLIP	24398324
MIRT502081	hsa-miR-548ah-3p	PAR-CLIP	24398324
MIRT502082	hsa-miR-548ae-3p	PAR-CLIP	24398324
MIRT502083	hsa-miR-429	PAR-CLIP	24398324
MIRT502084	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT502085	hsa-miR-193a-3p	PAR-CLIP	24398324
MIRT502085	hsa-miR-193a-3p	Luciferase reporter assay, Western blot	27669434
MIRT502086	hsa-miR-183-5p	PAR-CLIP	24398324
MIRT502087	hsa-miR-877-5p	PAR-CLIP	24398324
MIRT562032	hsa-miR-5010-3p	PAR-CLIP	20371350
MIRT562033	hsa-miR-642a-5p	PAR-CLIP	20371350
MIRT562034	hsa-miR-642b-5p	PAR-CLIP	20371350
MIRT562035	hsa-miR-124-5p	PAR-CLIP	20371350
MIRT562036	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT562037	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT562038	hsa-miR-513c-3p	PAR-CLIP	20371350
MIRT562039	hsa-miR-513a-3p	PAR-CLIP	20371350
MIRT562040	hsa-miR-3606-3p	PAR-CLIP	20371350
MIRT566990	hsa-miR-30e-3p	PAR-CLIP	20371350
MIRT566991	hsa-miR-30d-3p	PAR-CLIP	20371350
MIRT566992	hsa-miR-30a-3p	PAR-CLIP	20371350
MIRT566993	hsa-miR-4666b	PAR-CLIP	20371350
MIRT566994	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT566995	hsa-miR-4328	PAR-CLIP	20371350
MIRT566996	hsa-miR-4698	PAR-CLIP	20371350
MIRT731362	hsa-miR-1-3p	Luciferase reporter assay	26852690
MIRT731362	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	26275461
MIRT731411	hsa-miR-199a-5p	qRT-PCR, Western blot	26027911
MIRT732188	hsa-miR-543	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26968810
MIRT732429	hsa-miR-384	Luciferase reporter assay, qRT-PCR, Western blot	27769041
MIRT734871	hsa-miR-4689	Luciferase reporter assay, Western blot	25756961
MIRT735405	hsa-miR-613	Luciferase reporter assay, qRT-PCR, Western blot	26631045

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
MYC	Activation	21252116

Show/Hide all(46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0001889	Process	Liver development	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	22065586
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0003924	Function	GTPase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	12732644, 25416956, 25852190, 31980649
GO:0005525	Function	GTP binding	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	23698361
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007265	Process	Ras protein signal transduction	IBA	21873635
GO:0007265	Process	Ras protein signal transduction	TAS
GO:0007565	Process	Female pregnancy	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	23698361
GO:0008542	Process	Visual learning	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	22065586
GO:0016020	Component	Membrane	HDA	19946888
GO:0019002	Function	GMP binding	IEA
GO:0019003	Function	GDP binding	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0021897	Process	Forebrain astrocyte development	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030275	Function	LRR domain binding	IEA
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IDA	23698361
GO:0031647	Process	Regulation of protein stability	IMP	24623306
GO:0032228	Process	Regulation of synaptic transmission, GABAergic	IEA
GO:0035022	Process	Positive regulation of Rac protein signal transduction	IEA
GO:0035900	Process	Response to isolation stress	IEA
GO:0038002	Process	Endocrine signaling	IEA
GO:0043406	Process	Positive regulation of MAP kinase activity	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0044877	Function	Protein-containing complex binding	IDA	23209302
GO:0045121	Component	Membrane raft	IEA
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0048169	Process	Regulation of long-term neuronal synaptic plasticity	IEA
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0051000	Process	Positive regulation of nitric-oxide synthase activity	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IEA
GO:0051146	Process	Striated muscle cell differentiation	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051385	Process	Response to mineralocorticoid	IEA
GO:0060441	Process	Epithelial tube branching involved in lung morphogenesis	IEA
GO:2000774	Process	Positive regulation of cellular senescence	IEA

MIM	HGNC	e!Ensembl
190070	6407	ENSG00000133703

Protein

UniProt ID

P01116

Protein name

GTPase KRas (EC 3.6.5.2) (K-Ras 2) (Ki-Ras) (c-K-ras) (c-Ki-ras) [Cleaved into: GTPase KRas, N-terminally processed]

Protein function

Ras proteins bind GDP/GTP and possess intrinsic GTPase activity (PubMed:20949621). Plays an important role in the regulation of cell proliferation (PubMed:23698361, PubMed:22711838). Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner (PubMed:24623306).

PDB

1D8D , 1D8E , 1KZO , 1KZP , 1N4P , 1N4Q , 1N4R , 1N4S , 3GFT , 4DSN , 4DSO , 4EPR , 4EPT , 4EPV , 4EPW , 4EPX , 4EPY , 4L8G , 4LDJ , 4LPK , 4LRW , 4LUC , 4LV6 , 4LYF , 4LYH , 4LYJ , 4M1O , 4M1S , 4M1T , 4M1W , 4M1Y , 4M21 , 4M22 , 4NMM , 4OBE , 4PZY , 4PZZ , 4Q01 , 4Q02 , 4Q03 , 4QL3 , 4TQ9 , 4TQA , 4WA7 , 5F2E , 5KYK , 5MLA , 5MLB , 5O2S , 5O2T , 5OCG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	5 → 165	Ras family	Domain

Sequence

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM

Sequence length

189

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412