KIT (KIT proto-oncogene, receptor tyrosine kinase)

Gene

• Entrez ID: 3815
• Gene name: KIT proto-oncogene, receptor tyrosine kinase
• Gene symbol: KIT
• Synonyms: C-Kit, CD117, MASTC, PBT, SCFR
• Chromosome: 4
• Chromosome location: 4q12
• Summary: This gene encodes a receptor tyrosine kinase. This gene was initially identified as a homolog of the feline sarcoma viral oncogene v-kit and is often referred to as proto-oncogene c-Kit. The canonical form of this glycosylated transmembrane protein has an N-terminal extracellular region with five immunoglobulin-like domains, a transmembrane region, and an intracellular tyrosine kinase domain at the C-terminus. Upon activation by its cytokine ligand, stem cell factor (SCF), this protein phosphorylates multiple intracellular proteins that play a role in in the proliferation, differentiation, migration and apoptosis of many cell types and thereby plays an important role in hematopoiesis, stem cell maintenance, gametogenesis, melanogenesis, and in mast cell development, migration and function. This protein can be a membrane-bound or soluble protein. Mutations in this gene are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous leukemia, and piebaldism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2020]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs28933371	T>G	Pathogenic	Missense variant, coding sequence variant
rs121913234	AAACCCATGTATGAAGTACAGTGGAAG>-	Pathogenic	Coding sequence variant, splice acceptor variant
rs121913235	T>A,C,G	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs121913505	G>A	Likely-benign, uncertain-significance, likely-pathogenic	Missense variant, coding sequence variant
rs121913506	G>A,C,T	Other, pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs121913507	A>T	Other, pathogenic, uncertain-significance, likely-pathogenic	Missense variant, coding sequence variant
rs121913509	G>A	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs121913512	A>C,G	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs121913513	T>C	Not-provided, pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs121913514	T>A,G	Pathogenic, uncertain-significance, likely-pathogenic	Missense variant, coding sequence variant
rs121913516	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs121913517	T>A,C,G	Pathogenic, pathogenic-likely-pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs121913520	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs121913521	T>A,C,G	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs121913523	T>A,C	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs121913524	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs121913679	G>A	Pathogenic	Missense variant, coding sequence variant
rs121913680	G>A	Pathogenic	Missense variant, coding sequence variant
rs121913682	A>G,T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs121913684	A>G	Pathogenic	Missense variant, coding sequence variant
rs121913685	TTGTTG>-,TTG	Pathogenic, likely-pathogenic	Inframe deletion, coding sequence variant
rs121913687	A>C	Pathogenic	Missense variant, coding sequence variant
rs200375589	G>A,C,T	Pathogenic, likely-pathogenic, likely-benign	Coding sequence variant, synonymous variant, missense variant
rs387907217	T>C	Pathogenic	Coding sequence variant, missense variant
rs587776804	CCATGTATGAAGTAC>-	Pathogenic	Coding sequence variant, inframe deletion
rs753212327	C>A,G,T	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs763308199	C>A,T	Pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs773828910	G>A,C	Drug-response, uncertain-significance	Coding sequence variant, missense variant
rs794726671	T>C,G	Likely-benign, pathogenic	Synonymous variant, coding sequence variant, missense variant
rs794726672	AA>-	Pathogenic	Frameshift variant, coding sequence variant
rs794726673	->G	Pathogenic	Frameshift variant, coding sequence variant
rs794726674	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs794726675	G>A	Pathogenic	Splice donor variant
rs869025568	TGGAAG>-	Likely-pathogenic	Coding sequence variant, inframe deletion
rs886042030	CTTT>-	Pathogenic	Coding sequence variant, stop gained
rs993022333	A>C,T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs1057519701	G>A	Pathogenic	Coding sequence variant, missense variant
rs1057519702	T>C	Pathogenic	Coding sequence variant, missense variant
rs1057519703	A>C,T	Pathogenic	Coding sequence variant, missense variant
rs1057519704	T>A	Pathogenic	Coding sequence variant, missense variant
rs1057519705	A>G	Pathogenic	Coding sequence variant, missense variant
rs1057519706	T>G	Pathogenic	Coding sequence variant, missense variant
rs1057519707	A>G	Uncertain-significance, pathogenic	Coding sequence variant, missense variant
rs1057519708	T>A,G	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1057519709	GA>AT	Pathogenic	Coding sequence variant, missense variant
rs1057519710	G>C,T	Pathogenic	Coding sequence variant, missense variant
rs1057519711	T>A	Pathogenic	Coding sequence variant, missense variant
rs1057519713	G>C	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1057519761	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1057519907	A>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1057520031	A>C,G	Likely-pathogenic	Coding sequence variant, missense variant
rs1057520032	G>A,C	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant, stop gained
rs1057520033	G>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1057520035	GG>TT	Likely-pathogenic	Coding sequence variant, missense variant
rs1060502521	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1060502543	GAT>-	Pathogenic	Coding sequence variant, inframe deletion
rs1131692239	CTTATGATC>-	Pathogenic	Coding sequence variant, inframe deletion
rs1301704156	G>A	Likely-pathogenic	Splice donor variant
rs1306680919	C>T	Likely-pathogenic	Coding sequence variant, stop gained
rs1553887262	->T	Pathogenic	Coding sequence variant, frameshift variant
rs1553887960	TCAG>-	Pathogenic	Coding sequence variant, frameshift variant
rs1553890995	C>G	Conflicting-interpretations-of-pathogenicity	Intron variant
rs1560395607	A>-	Pathogenic	Frameshift variant, coding sequence variant
rs1560417385	CCATGTATGAAGTACAGTGGA>-	Likely-pathogenic	Inframe indel, coding sequence variant
rs1560417396	CATGTATG>AA	Likely-pathogenic	Inframe indel, coding sequence variant
rs1560417427	ACAGTGGA>CC	Likely-pathogenic	Inframe deletion, coding sequence variant
rs1560417438	GTGGAAGGTTGTTGAGGAG>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1560417535	TTGTTGAGGAGATAAATGGAAACAATTATGTTTACATAGACCCAA>-	Likely-pathogenic	Inframe indel, coding sequence variant
rs1560417642	->ACCCAACACAACTTCCTTATGATCACAAATGGGAGTTTCCCA	Likely-pathogenic	Inframe insertion, coding sequence variant
rs1560417666	->CACAACTTCCTTATGATCACAAATGGGAGTTTCCCAGAAACAGGC	Likely-pathogenic	Inframe insertion, coding sequence variant
rs1560417673	->ACAACTTCCTTATGATCACAAATGGGAGTTTCCCAGAAACAGGCT	Likely-pathogenic	Inframe insertion, coding sequence variant
rs1560418178	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1560419312	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1560420761	AC>-	Pathogenic	Stop gained, coding sequence variant
rs1577992594	A>T	Pathogenic	Coding sequence variant, missense variant
rs1577995761	A>G	Likely-pathogenic	Splice acceptor variant
rs1578003055	G>A	Likely-pathogenic	Splice acceptor variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001779	hsa-miR-222-3p	qRT-PCR, Western blot	18417445
MIRT001779	hsa-miR-222-3p	Luciferase reporter assay	18246122
MIRT001779	hsa-miR-222-3p	Luciferase reporter assay	18983236
MIRT001779	hsa-miR-222-3p	Northern blot, qRT-PCR, Western blot	16365291
MIRT001779	hsa-miR-222-3p	Reporter assay	16330772
MIRT001779	hsa-miR-222-3p	Luciferase reporter assay, qRT-PCR, microarray, Western blotting	23969726
MIRT001780	hsa-miR-221-3p	Luciferase reporter assay, qRT-PCR, Western blot	19088079
MIRT001780	hsa-miR-221-3p	qRT-PCR, Western blot	19126397
MIRT001780	hsa-miR-221-3p	Luciferase reporter assay	18246122
MIRT001780	hsa-miR-221-3p	Luciferase reporter assay	18983236
MIRT001780	hsa-miR-221-3p	qRT-PCR, Western blot	18417445
MIRT001780	hsa-miR-221-3p	Northern blot, qRT-PCR, Western blot	16365291
MIRT001780	hsa-miR-221-3p	Reporter assay;Microarray	20018759
MIRT001780	hsa-miR-221-3p	Reporter assay	16330772
MIRT005371	hsa-miR-146b-5p	Northern blot, qRT-PCR, Western blot	16365291
MIRT006179	hsa-miR-19a-3p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	21880628
MIRT006180	hsa-miR-20a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	21880628
MIRT017735	hsa-miR-335-5p	Microarray	18185580
MIRT021165	hsa-miR-186-5p	Sequencing	20371350
MIRT047222	hsa-miR-181c-5p	CLASH	23622248
MIRT054626	hsa-miR-199b-5p	ChIP-seq, Flow, qRT-PCR, Western blot	24608802
MIRT437423	hsa-miR-137	Luciferase reporter assay, qRT-PCR, Western blot	24465609
MIRT438239	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	24009080
MIRT438239	hsa-miR-34a-5p	Luciferase reporter assay	27056900
MIRT656851	hsa-miR-6736-5p	HITS-CLIP	23824327
MIRT656852	hsa-miR-4701-3p	HITS-CLIP	23824327
MIRT656853	hsa-miR-1262	HITS-CLIP	23824327
MIRT656854	hsa-miR-4504	HITS-CLIP	23824327
MIRT656855	hsa-miR-549a	HITS-CLIP	23824327
MIRT656856	hsa-miR-8063	HITS-CLIP	23824327
MIRT714711	hsa-miR-4774-5p	HITS-CLIP	19536157
MIRT714712	hsa-miR-4490	HITS-CLIP	19536157
MIRT714713	hsa-miR-517-5p	HITS-CLIP	19536157
MIRT714714	hsa-miR-4305	HITS-CLIP	19536157
MIRT714715	hsa-miR-4524b-3p	HITS-CLIP	19536157
MIRT714716	hsa-miR-5684	HITS-CLIP	19536157
MIRT733705	hsa-miR-218-5p	Luciferase reporter assay, qRT-PCR, Western blot	28314168
MIRT734593	hsa-miR-193b-3p	Luciferase reporter assay	26603207

Transcription factors

Transcription factor	Regulation	Reference
MITF	Activation	19937254
RBMX	Repression	16707624
SP1	Unknown	9834219
TFAP2A	Unknown	20805990

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000187	Process	Activation of MAPK activity	IDA	21640708
GO:0001541	Process	Ovarian follicle development	ISS
GO:0001650	Component	Fibrillar center	IDA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0002020	Function	Protease binding	IEA
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IBA	21873635
GO:0002318	Process	Myeloid progenitor cell differentiation	IEA
GO:0002320	Process	Lymphoid progenitor cell differentiation	IEA
GO:0002327	Process	Immature B cell differentiation	ISS
GO:0002371	Process	Dendritic cell cytokine production	ISS
GO:0002551	Process	Mast cell chemotaxis	IDA	20100931
GO:0004713	Function	Protein tyrosine kinase activity	TAS	1717985
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IBA	21873635
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IDA	21640708
GO:0005020	Function	Stem cell factor receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	1382595, 7523381, 7537096, 10377264, 10397721, 11018522, 12878163, 17662946, 24728074, 25241761
GO:0005524	Function	ATP binding	IEA
GO:0005615	Component	Extracellular space	IDA	14625290
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005911	Component	Cell-cell junction	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS
GO:0006687	Process	Glycosphingolipid metabolic process	IEA
GO:0006954	Process	Inflammatory response	ISS
GO:0007165	Process	Signal transduction	TAS	9990072
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IBA	21873635
GO:0007275	Process	Multicellular organism development	IBA	21873635
GO:0007283	Process	Spermatogenesis	ISS
GO:0007283	Process	Spermatogenesis	TAS	16129412
GO:0007286	Process	Spermatid development	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008354	Process	Germ cell migration	IEA
GO:0008360	Process	Regulation of cell shape	ISS
GO:0008542	Process	Visual learning	IEA
GO:0008584	Process	Male gonad development	IEP	17848411
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010863	Process	Positive regulation of phospholipase C activity	TAS	16129412
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	TAS	16129412
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	21640708
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	21640708
GO:0019827	Process	Stem cell population maintenance	TAS	21057534
GO:0019955	Function	Cytokine binding	IDA	21640708
GO:0030032	Process	Lamellipodium assembly	ISS
GO:0030097	Process	Hemopoiesis	TAS	16129412
GO:0030183	Process	B cell differentiation	IBA	21873635
GO:0030217	Process	T cell differentiation	ISS
GO:0030218	Process	Erythrocyte differentiation	ISS
GO:0030318	Process	Melanocyte differentiation	ISS
GO:0030318	Process	Melanocyte differentiation	TAS	21057534
GO:0030335	Process	Positive regulation of cell migration	IBA	21873635
GO:0031274	Process	Positive regulation of pseudopodium assembly	IEA
GO:0031532	Process	Actin cytoskeleton reorganization	IDA	1721869
GO:0032762	Process	Mast cell cytokine production	IDA	20100931
GO:0033674	Process	Positive regulation of kinase activity	IBA	21873635
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0035162	Process	Embryonic hemopoiesis	ISS
GO:0035234	Process	Ectopic germ cell programmed cell death	IEA
GO:0035701	Process	Hematopoietic stem cell migration	IEA
GO:0035855	Process	Megakaryocyte development	ISS
GO:0038093	Process	Fc receptor signaling pathway	IDA	20100931
GO:0038109	Process	Kit signaling pathway	IBA	21873635
GO:0038109	Process	Kit signaling pathway	IDA	17662946
GO:0038162	Process	Erythropoietin-mediated signaling pathway	ISS
GO:0042127	Process	Regulation of cell population proliferation	TAS	16129412, 21057534
GO:0042169	Function	SH2 domain binding	IEA
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IMP	21135090
GO:0042803	Function	Protein homodimerization activity	IPI	21640708
GO:0043069	Process	Negative regulation of programmed cell death	IEA
GO:0043235	Component	Receptor complex	IBA	21873635
GO:0043303	Process	Mast cell degranulation	IMP	20100931
GO:0043406	Process	Positive regulation of MAP kinase activity	IBA	21873635
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	21640708
GO:0043473	Process	Pigmentation	ISS
GO:0043552	Process	Positive regulation of phosphatidylinositol 3-kinase activity	TAS	16129412
GO:0043586	Process	Tongue development	IEA
GO:0045747	Process	Positive regulation of Notch signaling pathway	IEA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IBA	21873635
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IMP	21135090
GO:0046686	Process	Response to cadmium ion	IEA
GO:0046777	Process	Protein autophosphorylation	IDA	21640708
GO:0046872	Function	Metal ion binding	IEA
GO:0048103	Process	Somatic stem cell division	IEA
GO:0048170	Process	Positive regulation of long-term neuronal synaptic plasticity	IEA
GO:0048565	Process	Digestive tract development	ISS
GO:0048863	Process	Stem cell differentiation	ISS
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050910	Process	Detection of mechanical stimulus involved in sensory perception of sound	ISS
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	21135090
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0060326	Process	Cell chemotaxis	IDA	1721869
GO:0060374	Process	Mast cell differentiation	ISS
GO:0060374	Process	Mast cell differentiation	TAS	16129412
GO:0070662	Process	Mast cell proliferation	TAS	21057534
GO:0097067	Process	Cellular response to thyroid hormone stimulus	IEA
GO:0097324	Process	Melanocyte migration	ISS
GO:0097326	Process	Melanocyte adhesion	ISS
GO:0120072	Process	Positive regulation of pyloric antrum smooth muscle contraction	IEA
GO:1904251	Process	Regulation of bile acid metabolic process	IEA
GO:1904343	Process	Positive regulation of colon smooth muscle contraction	IEA
GO:1904349	Process	Positive regulation of small intestine smooth muscle contraction	IEA
GO:1905065	Process	Positive regulation of vascular associated smooth muscle cell differentiation	IDA	19088079

Other IDs

• MIM: 164920
• HGNC: 6342
• e!Ensembl: ENSG00000157404

Protein

• UniProt ID: P10721
• Protein name: Mast/stem cell growth factor receptor Kit (SCFR) (EC 2.7.10.1) (Piebald trait protein) (PBT) (Proto-oncogene c-Kit) (Tyrosine-protein kinase Kit) (p145 c-kit) (v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog) (CD antigen CD117)
• Protein function: Tyrosine-protein kinase that acts as cell-surface receptor for the cytokine KITLG/SCF and plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. In response to KITLG/SCF binding, KIT can activate several signaling pathways. Phosphorylates PIK3R1, PLCG1, SH2B2/APS and CBL. Activates the AKT1 signaling pathway by phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Activated KIT also transmits signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3, STAT5A and STAT5B. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KIT signaling is modulated by protein phosphatases, and by rapid internalization and degradation of the receptor. Activated KIT promotes phosphorylation of the protein phosphatases PTPN6/SHP-1 and PTPRU, and of the transcription factors STAT1, STAT3, STAT5A and STAT5B. Promotes phosphorylation of PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC and SHC1.
• PDB: 1PKG, 1QZJ, 1QZK, 1R01, 1T45, 1T46, 2E9W, 2EC8, 2IUH, 2VIF, 3G0E, 3G0F, 4HVS, 4K94, 4K9E, 4PGZ, 4U0I, 6GQJ, 6GQK, 6GQL, 6GQM, 6HH1, 6ITT, 6ITV, 6KLA, 6MOB, 6XV9, 6XVA, 6XVB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00047	ig	216 → 305	Immunoglobulin domain	Domain
  PF07714	PK_Tyr_Ser-Thr	589 → 924	Protein tyrosine and serine/threonine kinase	Domain

• Sequence:

  MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTD
  PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV
  DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYH
  RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS
  SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN
  VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE
  DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR
  LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDS
  SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV
  MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF
  GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC
  TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE
  YMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM
  AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES
  IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY
  DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV
  GSTASSSQPLLVHDDV

• Sequence length: 976