KCNK2 (potassium two pore domain channel subfamily K member 2)

Gene

• Entrez ID: 3776
• Gene name: Potassium two pore domain channel subfamily K member 2
• Gene symbol: KCNK2
• Synonyms: K2p2.1, TPKC1, TREK, TREK-1, TREK1, hTREK-1c, hTREK-1e
• Chromosome: 1
• Chromosome location: 1q41
• Summary: This gene encodes one of the members of the two-pore-domain background potassium channel protein family. This type of potassium channel is formed by two homodimers that create a channel that leaks potassium out of the cell to control resting membrane potential. The channel can be opened, however, by certain anesthetics, membrane stretching, intracellular acidosis, and heat. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022916	hsa-miR-124-3p	Microarray	18668037
MIRT642054	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT642055	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT642056	hsa-miR-4284	HITS-CLIP	23824327
MIRT642057	hsa-miR-3682-3p	HITS-CLIP	23824327
MIRT642058	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT642059	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT786547	hsa-miR-4729	HITS-CLIP	27418678
MIRT786640	hsa-miR-4760-5p	HITS-CLIP	27418678
MIRT787805	hsa-miR-5696	HITS-CLIP	27418678
MIRT789773	hsa-miR-8061	HITS-CLIP	27418678

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003231	Process	Cardiac ventricle development	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007613	Process	Memory	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010942	Process	Positive regulation of cell death	IEA
GO:0015271	Function	Outward rectifier potassium channel activity	IBA	21873635
GO:0015271	Function	Outward rectifier potassium channel activity	ISS
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022841	Function	Potassium ion leak channel activity	IBA	21873635
GO:0022841	Function	Potassium ion leak channel activity	ISS
GO:0030322	Process	Stabilization of membrane potential	IBA	21873635
GO:0043025	Component	Neuronal cell body	IEA
GO:0044305	Component	Calyx of Held	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0060044	Process	Negative regulation of cardiac muscle cell proliferation	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IBA	21873635
GO:0071805	Process	Potassium ion transmembrane transport	ISS
GO:0090102	Process	Cochlea development	IEA
GO:0097449	Component	Astrocyte projection	IEA
GO:1900039	Process	Positive regulation of cellular response to hypoxia	IEA
GO:2000279	Process	Negative regulation of DNA biosynthetic process	IEA

Other IDs

• MIM: 603219
• HGNC: 6277
• e!Ensembl: ENSG00000082482

Protein

• UniProt ID: O95069
• Protein name: Potassium channel subfamily K member 2 (Outward rectifying potassium channel protein TREK-1) (TREK-1 K(+) channel subunit) (Two pore domain potassium channel TREK-1) (Two pore potassium channel TPKC1)
• Protein function: Ion channel that contributes to passive transmembrane potassium transport (PubMed:23169818). Reversibly converts between a voltage-insensitive potassium leak channel and a voltage-dependent outward rectifying potassium channel in a phosphorylation-dependent manner (PubMed:11319556). In astrocytes, forms mostly heterodimeric potassium channels with KCNK1, with only a minor proportion of functional channels containing homodimeric KCNK2. In astrocytes, the heterodimer formed by KCNK1 and KCNK2 is required for rapid glutamate release in response to activation of G-protein coupled receptors, such as F2R and CNR1 (By similarity). ; [Isoform 4]: Does not display channel activity but reduces the channel activity of isoform 1 and isoform 2 and reduces cell surface expression of isoform 2.
• PDB: 4TWK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07885	Ion_trans_2	117 → 197	Ion channel	Family
  PF07885	Ion_trans_2	233 → 313	Ion channel	Family

• Sequence:

  MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWK
  TVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQ
  IVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALL
  GIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVAL
  PAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYF
  AAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATS
  IKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEIA
  VIENIK

• Sequence length: 426