GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

JUN (Jun proto-oncogene, AP-1 transcription factor subunit)

Gene

3725

Jun proto-oncogene, AP-1 transcription factor subunit

JUN

AP-1, AP1, c-Jun, cJUN, p39

1p32.1

This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. [provided by RefSeq, Jul 2008]

Show/Hide all(39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000867	hsa-miR-16-5p	Microarray	18362358
MIRT000868	hsa-miR-15a-5p	Microarray	18362358
MIRT005128	hsa-miR-30a-5p	pSILAC, Proteomics;Other	18668040
MIRT006208	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22508041
MIRT020367	hsa-miR-29c-3p	Sequencing	20371350
MIRT027318	hsa-miR-101-3p	Sequencing	20371350
MIRT029641	hsa-miR-26b-5p	Microarray	19088304
MIRT043728	hsa-miR-342-3p	CLASH	23622248
MIRT045693	hsa-miR-149-5p	CLASH	23622248
MIRT048821	hsa-miR-93-5p	CLASH	23622248
MIRT053050	hsa-miR-203a-3p	Immunoblot, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR	23552555
MIRT054258	hsa-miR-139-5p	ChIP-seq, Flow, Luciferase reporter assay, qRT-PCR, Western blot	25499265
MIRT115283	hsa-miR-149-3p	PAR-CLIP	22100165
MIRT115286	hsa-miR-4728-5p	PAR-CLIP	22100165
MIRT115291	hsa-miR-6785-5p	PAR-CLIP	22100165
MIRT115299	hsa-miR-6883-5p	PAR-CLIP	22100165
MIRT260042	hsa-miR-1321	PAR-CLIP	22100165
MIRT260049	hsa-miR-4739	PAR-CLIP	22100165
MIRT260051	hsa-miR-4756-5p	PAR-CLIP	22100165
MIRT403890	hsa-miR-3691-3p	PAR-CLIP	22100165
MIRT443327	hsa-miR-3178	PAR-CLIP	22100165
MIRT443328	hsa-miR-4783-5p	PAR-CLIP	22100165
MIRT443329	hsa-miR-4480	PAR-CLIP	22100165
MIRT502173	hsa-miR-655-3p	PAR-CLIP	24398324
MIRT502174	hsa-miR-374c-5p	PAR-CLIP	24398324
MIRT502175	hsa-miR-4724-5p	PAR-CLIP	24398324
MIRT502176	hsa-miR-8084	PAR-CLIP	24398324
MIRT502177	hsa-miR-429	PAR-CLIP	24398324
MIRT502178	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT502178	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	27979826
MIRT502179	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT560406	hsa-miR-2681-5p	PAR-CLIP	20371350
MIRT560407	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT560408	hsa-miR-633	PAR-CLIP	20371350
MIRT560409	hsa-miR-4720-3p	PAR-CLIP	20371350
MIRT560410	hsa-miR-4804-3p	PAR-CLIP	20371350
MIRT560411	hsa-miR-4328	PAR-CLIP	20371350
MIRT731173	hsa-miR-1470	qRT-PCR, Luciferase reporter assay, Western blot	25545366
MIRT734962	hsa-miR-216b-5p	Luciferase reporter assay	27173017

Transcription factors

Show/Hide all(38)

Transcription factor	Regulation	Reference
ABL1	Activation	15145216
ABL1	Repression	19357699
AR	Activation	20148354
ARNT	Repression	21544813
ATF2	Activation	9502786
CREB1	Repression	8647095
CREB1	Unknown	10403485
CTNNB1	Activation	20300972
CTNNB1	Unknown	19671687
ESR1	Activation	11477071
ESR1	Unknown	10037443
ESR2	Unknown	10037443
GLI1	Unknown	19219074
GLI2	Unknown	19219074
HDAC3	Repression	17244530
HDAC4	Activation	10523670
HDAC4	Repression	10523670
HSF1	Unknown	24127737
JUN	Activation	9502786
JUN	Unknown	19671687
MEF2A	Activation	12054430
MEF2A	Unknown	10403485
MEF2C	Activation	10523670;12054430
MEF2C	Repression	10523670
MEF2C	Unknown	10849446
MEF2D	Activation	12054430
NFIC	Unknown	10403485
NFRKB	Activation	22291976
PARP1	Unknown	16026317
PITX1	Repression	21425961
RUNX1	Activation	20959602
SMAD3	Unknown	10022869
SMAD4	Unknown	10022869
TCF4	Unknown	19671687
TNFAIP3	Repression	19124729
WT1	Activation	20842112
ZNF382	Repression	20682794
ZNF383	Repression	15964543

Show/Hide all(81)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	2833704
GO:0000228	Component	Nuclear chromosome	TAS	10918580
GO:0000785	Component	Chromatin	ISA
GO:0000791	Component	Euchromatin	IDA	19861239
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IDA	2833704, 9732876, 14645924, 21113145, 22083952, 24623306
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19861239
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IC	21113145
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	2833704, 19861239
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001102	Function	RNA polymerase II activating transcription factor binding	IPI	10508860, 19861239
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	2833704
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	2833704, 19861239
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	19962668
GO:0001525	Process	Angiogenesis	IEA
GO:0001836	Process	Release of cytochrome c from mitochondria	IEA
GO:0003677	Function	DNA binding	TAS	2825349
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9732876
GO:0003723	Function	RNA binding	HDA	22681889
GO:0005096	Function	GTPase activator activity	IDA	11804590
GO:0005515	Function	Protein binding	IPI	7816143, 8440710, 10327051, 10393177, 10428834, 11738026, 12676957, 15334056, 15378002, 15626733, 15894542, 16291755, 16533805, 18003900, 18165900, 18172215, 19028685, 19064921, 19074269, 19527717, 20102225, 20195357, 20511396, 20557936, 20852630, 20936779, 21199371, 21555589, 21988
GO:0005634	Component	Nucleus	IDA	21113145
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA	21873635
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	9732876
GO:0007265	Process	Ras protein signal transduction	IDA	24623306
GO:0007568	Process	Aging	IEA
GO:0007612	Process	Learning	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008134	Function	Transcription factor binding	IBA	21873635
GO:0008134	Function	Transcription factor binding	IPI	16007074
GO:0009314	Process	Response to radiation	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	14739464
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0034614	Process	Cellular response to reactive oxygen species	IMP	26514923
GO:0035497	Function	CAMP response element binding	IDA	19861239
GO:0035976	Component	Transcription factor AP-1 complex	IDA	10508860
GO:0035976	Component	Transcription factor AP-1 complex	IMP	26514923
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042127	Process	Regulation of cell population proliferation	IBA	21873635
GO:0042493	Process	Response to drug	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042802	Function	Identical protein binding	IPI	8662824, 20102225, 25609649
GO:0043065	Process	Positive regulation of apoptotic process	IMP	10508860
GO:0043392	Process	Negative regulation of DNA binding	IDA	14645924
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043547	Process	Positive regulation of GTPase activity	IEA
GO:0043922	Process	Negative regulation by host of viral transcription	IDA	2833704
GO:0043923	Process	Positive regulation by host of viral transcription	IDA	2833704
GO:0044389	Function	Ubiquitin-like protein ligase binding	IPI	27458189
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045657	Process	Positive regulation of monocyte differentiation	IEA
GO:0045740	Process	Positive regulation of DNA replication	IEA
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	2833704
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	2833704, 9732876, 22083952
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IMP	26514923
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	2833704, 10508860, 12490281, 19861239
GO:0051090	Process	Regulation of DNA-binding transcription factor activity	TAS
GO:0051365	Process	Cellular response to potassium ion starvation	IEA
GO:0051591	Process	Response to cAMP	IEA
GO:0051726	Process	Regulation of cell cycle	IBA	21873635
GO:0051899	Process	Membrane depolarization	IEA
GO:0060395	Process	SMAD protein signal transduction	IDA	9732876
GO:0070412	Function	R-SMAD binding	IPI	9732876
GO:0071276	Process	Cellular response to cadmium ion	IMP	26514923
GO:0071837	Function	HMG box domain binding	IEA
GO:1902895	Process	Positive regulation of pri-miRNA transcription by RNA polymerase II	IMP	19962668, 24375836
GO:1902895	Process	Positive regulation of pri-miRNA transcription by RNA polymerase II	ISS
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IMP	28701355
GO:1990441	Process	Negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IMP	21113145
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000144	Process	Positive regulation of DNA-templated transcription, initiation	IDA	23027619

MIM	HGNC	e!Ensembl
165160	6204	ENSG00000177606

Protein

UniProt ID

P05412

Protein name

Transcription factor AP-1 (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39)

Protein function

Transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3' (PubMed:10995748, PubMed:22083952). Promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation (PubMed:17210646). Involved in activated KRAS-mediated transcriptional activation of USP28 in colorectal cancer (CRC) cells (PubMed:24623306). Binds to the USP28 promoter in colorectal cancer (CRC) cells (PubMed:24623306).

PDB

1A02 , 1FOS , 1JNM , 1JUN , 1S9K , 1T2K , 5FV8 , 5T01 , 6Y3V

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03957	Jun	5 → 241	Jun-like transcription factor	Family
PF00170	bZIP_1	250 → 313	bZIP transcription factor	Coiled-coil

Sequence

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Sequence length

331

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412