GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

JAK2 (Janus kinase 2)

Gene

Janus kinase 2

JAK2

JTK10

9

9p24.1

This gene encodes a non-receptor tyrosine kinase that plays a central role in cytokine and growth factor signalling. The primary isoform of this protein has an N-terminal FERM domain that is required for erythropoietin receptor association, an SH2 domain

Show/Hide all(218)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000707	hsa-miR-135a-5p	Luciferase reporter assay, Western blot	19666866
MIRT000707	hsa-miR-135a-5p	Luciferase reporter assay	19666866
MIRT001749	hsa-miR-375	Luciferase reporter assay, Western blot	20548334
MIRT001749	hsa-miR-375	Luciferase reporter assay, Western blot	20548334
MIRT001749	hsa-miR-375	Luciferase reporter assay, Western blot	20548334
MIRT001749	hsa-miR-375	Luciferase reporter assay, Western blot	20548334
MIRT001749	hsa-miR-375	Luciferase reporter assay, Western blot	20548334
MIRT001749	hsa-miR-375	Luciferase reporter assay, Western blot	20548334
MIRT001749	hsa-miR-375	Luciferase reporter assay, Western blot	20548334
MIRT001749	hsa-miR-375	Luciferase reporter assay, Western blot	20548334
MIRT017973	hsa-miR-335-5p	Microarray	18185580
MIRT001749	hsa-miR-375	Reporter assay;Western blot	20548334
MIRT001749	hsa-miR-375	Reporter assay	15806104
MIRT051067	hsa-miR-16-5p	CLASH	23622248
MIRT044858	hsa-miR-195-5p	CLASH	23622248
MIRT000707	hsa-miR-135a-5p	qRT-PCR, Western blot	22310976
MIRT000707	hsa-miR-135a-5p	qRT-PCR, Western blot	22310976
MIRT001749	hsa-miR-375	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24718681
MIRT001749	hsa-miR-375	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24718681
MIRT001749	hsa-miR-375	Luciferase reporter assay, qRT-PCR	25055044
MIRT678309	hsa-miR-5692a	HITS-CLIP	22927820
MIRT623561	hsa-miR-8485	HITS-CLIP	22927820
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	22927820
MIRT623561	hsa-miR-8485	HITS-CLIP	22927820
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23313552
MIRT678309	hsa-miR-5692a	HITS-CLIP	23313552
MIRT623561	hsa-miR-8485	HITS-CLIP	23313552
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23313552
MIRT623561	hsa-miR-8485	HITS-CLIP	23313552
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT678309	hsa-miR-5692a	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT678308	hsa-miR-568	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT379479	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	26498873
MIRT379479	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	26498873
MIRT001749	hsa-miR-375	Western blot	28186962
MIRT001749	hsa-miR-375	Luciferase reporter assay	28006751
MIRT379479	hsa-miR-101-3p	Flow, qRT-PCR	27517565
MIRT678309	hsa-miR-5692a	HITS-CLIP	27418678
MIRT623561	hsa-miR-8485	HITS-CLIP	27418678
MIRT001749	hsa-miR-375	ELISA, qRT-PCR, Western blotting	33938607
MIRT001749	hsa-miR-375	Luciferase reporter assay, Western blotting, qRT-PCR	32045921
MIRT678309	hsa-miR-5692a	HITS-CLIP	22927820
MIRT623561	hsa-miR-8485	HITS-CLIP	22927820
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	22927820
MIRT623561	hsa-miR-8485	HITS-CLIP	22927820
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23313552
MIRT678309	hsa-miR-5692a	HITS-CLIP	23313552
MIRT623561	hsa-miR-8485	HITS-CLIP	23313552
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23313552
MIRT623561	hsa-miR-8485	HITS-CLIP	23313552
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT678309	hsa-miR-5692a	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT678308	hsa-miR-568	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT000707	hsa-miR-135a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34176097
MIRT756314	rno-miR-21-5p	Western blotting	37641874
MIRT756359	hsa-miR-4429	Luciferase reporter assay, Western blotting, qRT-PCR	35722358
MIRT1076121	hsa-miR-106a	CLIP-seq
MIRT1076122	hsa-miR-106b	CLIP-seq
MIRT1076123	hsa-miR-1182	CLIP-seq
MIRT1076124	hsa-miR-1256	CLIP-seq
MIRT1076125	hsa-miR-1284	CLIP-seq
MIRT1076126	hsa-miR-1343	CLIP-seq
MIRT1076127	hsa-miR-17	CLIP-seq
MIRT1076128	hsa-miR-20a	CLIP-seq
MIRT1076129	hsa-miR-20b	CLIP-seq
MIRT1076130	hsa-miR-214	CLIP-seq
MIRT1076131	hsa-miR-23a	CLIP-seq
MIRT1076132	hsa-miR-23b	CLIP-seq
MIRT1076133	hsa-miR-23c	CLIP-seq
MIRT1076134	hsa-miR-2909	CLIP-seq
MIRT1076135	hsa-miR-300	CLIP-seq
MIRT1076136	hsa-miR-3143	CLIP-seq
MIRT1076137	hsa-miR-3145-3p	CLIP-seq
MIRT1076138	hsa-miR-3171	CLIP-seq
MIRT1076139	hsa-miR-337-3p	CLIP-seq
MIRT1076140	hsa-miR-338-5p	CLIP-seq
MIRT1076141	hsa-miR-34a	CLIP-seq
MIRT1076142	hsa-miR-34c-5p	CLIP-seq
MIRT1076143	hsa-miR-3609	CLIP-seq
MIRT1076144	hsa-miR-3619-5p	CLIP-seq
MIRT1076145	hsa-miR-3658	CLIP-seq
MIRT1076146	hsa-miR-3685	CLIP-seq
MIRT1076147	hsa-miR-381	CLIP-seq
MIRT1076148	hsa-miR-384	CLIP-seq
MIRT1076149	hsa-miR-4270	CLIP-seq
MIRT1076150	hsa-miR-4282	CLIP-seq
MIRT1076151	hsa-miR-4291	CLIP-seq
MIRT1076152	hsa-miR-4318	CLIP-seq
MIRT1076153	hsa-miR-433	CLIP-seq
MIRT1076154	hsa-miR-4426	CLIP-seq
MIRT1076155	hsa-miR-4441	CLIP-seq
MIRT1076156	hsa-miR-4468	CLIP-seq
MIRT1076157	hsa-miR-449a	CLIP-seq
MIRT1076158	hsa-miR-449b	CLIP-seq
MIRT1076159	hsa-miR-4509	CLIP-seq
MIRT1076160	hsa-miR-4536	CLIP-seq
MIRT1076161	hsa-miR-4647	CLIP-seq
MIRT1076162	hsa-miR-4660	CLIP-seq
MIRT1076163	hsa-miR-4662b	CLIP-seq
MIRT1076164	hsa-miR-4666-3p	CLIP-seq
MIRT1076165	hsa-miR-4678	CLIP-seq
MIRT1076166	hsa-miR-4720-5p	CLIP-seq
MIRT1076167	hsa-miR-4744	CLIP-seq
MIRT1076168	hsa-miR-4756-3p	CLIP-seq
MIRT1076169	hsa-miR-4778-5p	CLIP-seq
MIRT1076170	hsa-miR-4789-5p	CLIP-seq
MIRT1076171	hsa-miR-4795-3p	CLIP-seq
MIRT1076172	hsa-miR-4796-3p	CLIP-seq
MIRT1076173	hsa-miR-4799-3p	CLIP-seq
MIRT1076174	hsa-miR-495	CLIP-seq
MIRT1076175	hsa-miR-5096	CLIP-seq
MIRT1076176	hsa-miR-513a-3p	CLIP-seq
MIRT1076177	hsa-miR-518a-5p	CLIP-seq
MIRT1076178	hsa-miR-519d	CLIP-seq
MIRT1076179	hsa-miR-527	CLIP-seq
MIRT1076180	hsa-miR-543	CLIP-seq
MIRT1076181	hsa-miR-548a-3p	CLIP-seq
MIRT1076182	hsa-miR-548ac	CLIP-seq
MIRT1076183	hsa-miR-548ae	CLIP-seq
MIRT1076184	hsa-miR-548ah	CLIP-seq
MIRT1076185	hsa-miR-548aj	CLIP-seq
MIRT1076186	hsa-miR-548am	CLIP-seq
MIRT1076187	hsa-miR-548d-3p	CLIP-seq
MIRT1076188	hsa-miR-548e	CLIP-seq
MIRT1076189	hsa-miR-548f	CLIP-seq
MIRT1076190	hsa-miR-548x	CLIP-seq
MIRT1076191	hsa-miR-548z	CLIP-seq
MIRT1076192	hsa-miR-605	CLIP-seq
MIRT1076193	hsa-miR-610	CLIP-seq
MIRT1076194	hsa-miR-646	CLIP-seq
MIRT1076195	hsa-miR-761	CLIP-seq
MIRT1076196	hsa-miR-922	CLIP-seq
MIRT1076197	hsa-miR-93	CLIP-seq
MIRT1076125	hsa-miR-1284	CLIP-seq
MIRT2018949	hsa-miR-3120-3p	CLIP-seq
MIRT2018950	hsa-miR-4521	CLIP-seq
MIRT2018951	hsa-miR-4639-5p	CLIP-seq
MIRT2018952	hsa-miR-4668-3p	CLIP-seq
MIRT2018953	hsa-miR-4698	CLIP-seq
MIRT1076170	hsa-miR-4789-5p	CLIP-seq
MIRT2018954	hsa-miR-500a	CLIP-seq
MIRT2018955	hsa-miR-520d-5p	CLIP-seq
MIRT2018956	hsa-miR-524-5p	CLIP-seq
MIRT2018957	hsa-miR-579	CLIP-seq
MIRT2018958	hsa-miR-600	CLIP-seq
MIRT2018959	hsa-miR-607	CLIP-seq
MIRT2250778	hsa-miR-370	CLIP-seq
MIRT2250779	hsa-miR-4325	CLIP-seq
MIRT2018953	hsa-miR-4698	CLIP-seq
MIRT2250780	hsa-miR-4793-3p	CLIP-seq
MIRT2250781	hsa-miR-556-5p	CLIP-seq
MIRT2018957	hsa-miR-579	CLIP-seq
MIRT2018959	hsa-miR-607	CLIP-seq
MIRT1076193	hsa-miR-610	CLIP-seq
MIRT2554255	hsa-miR-362-5p	CLIP-seq
MIRT2554256	hsa-miR-3653	CLIP-seq
MIRT1076145	hsa-miR-3658	CLIP-seq
MIRT2018950	hsa-miR-4521	CLIP-seq
MIRT2018951	hsa-miR-4639-5p	CLIP-seq
MIRT2018952	hsa-miR-4668-3p	CLIP-seq
MIRT2018954	hsa-miR-500a	CLIP-seq
MIRT2554257	hsa-miR-500b	CLIP-seq
MIRT2554258	hsa-miR-502-5p	CLIP-seq
MIRT2554259	hsa-miR-511	CLIP-seq
MIRT2018955	hsa-miR-520d-5p	CLIP-seq
MIRT2018956	hsa-miR-524-5p	CLIP-seq
MIRT2018958	hsa-miR-600	CLIP-seq
MIRT2554255	hsa-miR-362-5p	CLIP-seq
MIRT2554256	hsa-miR-3653	CLIP-seq
MIRT1076145	hsa-miR-3658	CLIP-seq
MIRT2683087	hsa-miR-4456	CLIP-seq
MIRT2018950	hsa-miR-4521	CLIP-seq
MIRT2018951	hsa-miR-4639-5p	CLIP-seq
MIRT2018952	hsa-miR-4668-3p	CLIP-seq
MIRT2683088	hsa-miR-4757-5p	CLIP-seq
MIRT2018954	hsa-miR-500a	CLIP-seq
MIRT2554257	hsa-miR-500b	CLIP-seq
MIRT2554258	hsa-miR-502-5p	CLIP-seq
MIRT2554259	hsa-miR-511	CLIP-seq
MIRT2018955	hsa-miR-520d-5p	CLIP-seq
MIRT2018956	hsa-miR-524-5p	CLIP-seq
MIRT2018958	hsa-miR-600	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
BRCA1	Unknown	11163768
ESR1	Unknown	19876927
STAT1	Activation	21239533
STAT3	Activation	17151100
STAT3	Unknown	19783654

Show/Hide all(134)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000186	Process	Activation of MAPKK activity	IEA
GO:0000791	Component	Euchromatin	IEA
GO:0001774	Process	Microglial cell activation	ISS
GO:0002250	Process	Adaptive immune response	IEA
GO:0004672	Function	Protein kinase activity	TAS
GO:0004713	Function	Protein tyrosine kinase activity	EXP	9111318, 15143187, 19665053, 20304997
GO:0004713	Function	Protein tyrosine kinase activity	IDA	23061660
GO:0004713	Function	Protein tyrosine kinase activity	ISS
GO:0004713	Function	Protein tyrosine kinase activity	TAS
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS
GO:0005102	Function	Signaling receptor binding	IPI	11201744
GO:0005131	Function	Growth hormone receptor binding	IBA	21873635
GO:0005131	Function	Growth hormone receptor binding	ISS
GO:0005143	Function	Interleukin-12 receptor binding	ISS
GO:0005515	Function	Protein binding	IPI	9516124, 11679576, 11694501, 11970898, 15821101, 16437163, 17474147, 18692472, 19234114, 20353823, 21806020, 24931576, 25092874, 26175413, 30413785
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	10502458, 19783980
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	10502458
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005901	Component	Caveola	ISS
GO:0005925	Component	Focal adhesion	IDA
GO:0006468	Process	Protein phosphorylation	TAS	9670957
GO:0006915	Process	Apoptotic process	ISS
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	ISS
GO:0007165	Process	Signal transduction	ISS
GO:0007167	Process	Enzyme linked receptor protein signaling pathway	ISS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007259	Process	Receptor signaling pathway via JAK-STAT	ISS
GO:0007260	Process	Tyrosine phosphorylation of STAT protein	IBA	21873635
GO:0007260	Process	Tyrosine phosphorylation of STAT protein	ISS
GO:0007498	Process	Mesoderm development	TAS	9590174
GO:0007596	Process	Blood coagulation	TAS
GO:0008022	Function	Protein C-terminus binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IEA
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IEA
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IDA	10925297
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	ISS
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	TAS
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	8609418
GO:0019221	Process	Cytokine-mediated signaling pathway	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019901	Function	Protein kinase binding	IDA	10925297
GO:0020037	Function	Heme binding	IDA	21036157
GO:0022408	Process	Negative regulation of cell-cell adhesion	IEA
GO:0030041	Process	Actin filament polymerization	NAS	10925297
GO:0030154	Process	Cell differentiation	ISS
GO:0030218	Process	Erythrocyte differentiation	IBA	21873635
GO:0030218	Process	Erythrocyte differentiation	ISS
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0031103	Process	Axon regeneration	IEA
GO:0031702	Function	Type 1 angiotensin receptor binding	IEA
GO:0031904	Component	Endosome lumen	TAS
GO:0031959	Process	Mineralocorticoid receptor signaling pathway	IEA
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032496	Process	Response to lipopolysaccharide	ISS
GO:0032516	Process	Positive regulation of phosphoprotein phosphatase activity	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0033130	Function	Acetylcholine receptor binding	IEA
GO:0033194	Process	Response to hydroperoxide	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IDA	8609418
GO:0034612	Process	Response to tumor necrosis factor	IDA	8609418
GO:0035401	Function	Histone kinase activity (H3-Y41 specific)	IBA	21873635
GO:0035401	Function	Histone kinase activity (H3-Y41 specific)	IDA	19783980
GO:0035409	Process	Histone H3-Y41 phosphorylation	IBA	21873635
GO:0035409	Process	Histone H3-Y41 phosphorylation	IDA	19783980
GO:0035556	Process	Intracellular signal transduction	ISS
GO:0035722	Process	Interleukin-12-mediated signaling pathway	IDA	7528775
GO:0035722	Process	Interleukin-12-mediated signaling pathway	TAS
GO:0038155	Process	Interleukin-23-mediated signaling pathway	TAS
GO:0042169	Function	SH2 domain binding	IPI	9727029
GO:0042307	Process	Positive regulation of protein import into nucleus	IEA
GO:0042393	Function	Histone binding	IDA	19783980
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	ISS
GO:0042802	Function	Identical protein binding	IPI	21841788, 22820988
GO:0042976	Process	Activation of Janus kinase activity	ISS
GO:0042981	Process	Regulation of apoptotic process	IBA	21873635
GO:0043388	Process	Positive regulation of DNA binding	IEA
GO:0043392	Process	Negative regulation of DNA binding	ISS
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IEA
GO:0043560	Function	Insulin receptor substrate binding	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0045348	Process	Positive regulation of MHC class II biosynthetic process	ISS
GO:0045428	Process	Regulation of nitric oxide biosynthetic process	ISS
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045822	Process	Negative regulation of heart contraction	IEA
GO:0046425	Process	Regulation of receptor signaling pathway via JAK-STAT	ISS
GO:0046579	Process	Positive regulation of Ras protein signal transduction	TAS
GO:0046677	Process	Response to antibiotic	IDA	16280321
GO:0046777	Process	Protein autophosphorylation	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IEA
GO:0050727	Process	Regulation of inflammatory response	IDA	10925297
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	ISS
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050867	Process	Positive regulation of cell activation	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IEA
GO:0051428	Function	Peptide hormone receptor binding	IEA
GO:0051770	Process	Positive regulation of nitric-oxide synthase biosynthetic process	ISS
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:0060334	Process	Regulation of interferon-gamma-mediated signaling pathway	TAS
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IGI	28334068
GO:0060396	Process	Growth hormone receptor signaling pathway	IDA	10925297
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	ISS
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	TAS
GO:0060399	Process	Positive regulation of growth hormone receptor signaling pathway	ISS
GO:0061180	Process	Mammary gland epithelium development	ISS
GO:0070102	Process	Interleukin-6-mediated signaling pathway	TAS
GO:0070106	Process	Interleukin-27-mediated signaling pathway	TAS
GO:0070671	Process	Response to interleukin-12	IDA	7528775
GO:0070757	Process	Interleukin-35-mediated signaling pathway	TAS
GO:0097191	Process	Extrinsic apoptotic signaling pathway	ISS
GO:0097296	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	ISS
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099527	Process	Postsynapse to nucleus signaling pathway	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	26515423
GO:1902728	Process	Positive regulation of growth factor dependent skeletal muscle satellite cell proliferation	IEA
GO:1904037	Process	Positive regulation of epithelial cell apoptotic process	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IEA
GO:2000273	Process	Positive regulation of signaling receptor activity	ISS

MIM	HGNC	e!Ensembl
147796	6192	ENSG00000096968

Protein

UniProt ID

Protein name

Tyrosine-protein kinase JAK2 (EC 2.7.10.2) (Janus kinase 2) (JAK-2)

Protein function

Non-receptor tyrosine kinase involved in various processes such as cell growth, development, differentiation or histone modifications. Mediates essential signaling events in both innate and adaptive immunity. In the cytoplasm, plays a pivotal ro

PDB

2B7A , 2W1I , 2XA4 , 3E62 , 3E63 , 3E64 , 3FUP , 3IO7 , 3IOK , 3JY9 , 3KCK , 3KRR , 3LPB , 3Q32 , 3RVG , 3TJC , 3TJD , 3UGC , 3ZMM , 4AQC , 4BBE , 4BBF , 4C61 , 4C62 , 4D0W , 4D0X , 4D1S , 4E4M , 4E6D , 4E6Q , 4F08 , 4F09 , 4FVP , 4FVQ , 4FVR , 4GFM , 4GMY , 4HGE , 4IVA , 4JI9 , 4JIA , 4P7E , 4YTC , 4YTF , 4YTH , 4YTI , 4Z32 , 4ZIM , 5AEP , 5CF4 , 5CF5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18379	FERM_F1	39 → 134	FERM F1 ubiquitin-like domain	Domain
PF18377	FERM_F2	142 → 261	FERM F2 acyl-CoA binding protein-like domain	Domain
PF17887	Jak1_Phl	299 → 381	Jak1 pleckstrin homology-like domain	Domain
PF00017	SH2	400 → 481	SH2 domain	Domain
PF07714	PK_Tyr_Ser-Thr	545 → 805	Protein tyrosine and serine/threonine kinase	Domain
PF07714	PK_Tyr_Ser-Thr	849 → 1123	Protein tyrosine and serine/threonine kinase	Domain

Sequence

MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSG
EYVAEEICIAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYF
PRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG
MAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQF
SQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNC
YQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI
RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWA
MHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAEL
ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG

Sequence length

1132

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412