ITGAM (integrin subunit alpha M)

Gene

• Entrez ID: 3684
• Gene name: Integrin subunit alpha M
• Gene symbol: ITGAM
• Synonyms: CD11B, CR3A, MAC-1, MAC1A, MO1A, SLEB6
• Chromosome: 16
• Chromosome location: 16p11.2
• Summary: This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific i

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1073816	hsa-miR-203	CLIP-seq
MIRT1073817	hsa-miR-224	CLIP-seq
MIRT1073818	hsa-miR-23a	CLIP-seq
MIRT1073819	hsa-miR-23b	CLIP-seq
MIRT1073820	hsa-miR-23c	CLIP-seq
MIRT1073821	hsa-miR-338-3p	CLIP-seq
MIRT1073822	hsa-miR-4488	CLIP-seq
MIRT1073823	hsa-miR-4489	CLIP-seq
MIRT1073824	hsa-miR-4530	CLIP-seq
MIRT1073825	hsa-miR-4643	CLIP-seq
MIRT1073826	hsa-miR-4697-5p	CLIP-seq
MIRT1073827	hsa-miR-517b	CLIP-seq
MIRT1073828	hsa-miR-603	CLIP-seq
MIRT1073829	hsa-miR-637	CLIP-seq
MIRT1073830	hsa-miR-661	CLIP-seq
MIRT1073825	hsa-miR-4643	CLIP-seq
MIRT1073828	hsa-miR-603	CLIP-seq
MIRT2250108	hsa-miR-342-3p	CLIP-seq
MIRT2250109	hsa-miR-3650	CLIP-seq
MIRT2250110	hsa-miR-377	CLIP-seq
MIRT1073825	hsa-miR-4643	CLIP-seq
MIRT2250111	hsa-miR-4717-3p	CLIP-seq
MIRT2250112	hsa-miR-4802-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SPI1	Activation	15163413;8095266;9295016

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IC
GO:0001774	Process	Microglial cell activation	ISS
GO:0001851	Function	Complement component C3b binding	ISS
GO:0005178	Function	Integrin binding	NAS	20199584
GO:0005515	Function	Protein binding	IPI	12208882, 15004192, 15194813, 16246332, 21193407, 28939773, 32296183
GO:0005615	Component	Extracellular space	IDA	25645918
GO:0005886	Component	Plasma membrane	IDA	28807980
GO:0005886	Component	Plasma membrane	TAS
GO:0006898	Process	Receptor-mediated endocytosis	ISS
GO:0006911	Process	Phagocytosis, engulfment	ISS
GO:0007155	Process	Cell adhesion	TAS	2563162
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0008305	Component	Integrin complex	TAS	2563162
GO:0009897	Component	External side of plasma membrane	NAS	20199584
GO:0009986	Component	Cell surface	HDA	23981064
GO:0009986	Component	Cell surface	IDA	19234460
GO:0010668	Process	Ectodermal cell differentiation	IEP	23154389
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0030198	Process	Extracellular matrix organization	TAS
GO:0030900	Process	Forebrain development	ISS
GO:0031072	Function	Heat shock protein binding	IPI	12496435
GO:0032930	Process	Positive regulation of superoxide anion generation	IGI	21193407
GO:0032930	Process	Positive regulation of superoxide anion generation	ISS
GO:0034142	Process	Toll-like receptor 4 signaling pathway	TAS
GO:0034688	Component	Integrin alphaM-beta2 complex	ISS
GO:0035579	Component	Specific granule membrane	TAS
GO:0038024	Function	Cargo receptor activity	ISS
GO:0038024	Function	Cargo receptor activity	ISS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043315	Process	Positive regulation of neutrophil degranulation	IGI	21193407
GO:0044853	Component	Plasma membrane raft	IDA	21193407
GO:0045087	Process	Innate immune response	IEA
GO:0045963	Process	Negative regulation of dopamine metabolic process	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0050900	Process	Leukocyte migration	TAS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0090314	Process	Positive regulation of protein targeting to membrane	ISS
GO:0097190	Process	Apoptotic signaling pathway	ISS
GO:0097242	Process	Amyloid-beta clearance	ISS
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	NAS	20199584
GO:0110090	Process	Positive regulation of hippocampal neuron apoptotic process	ISS
GO:0150062	Process	Complement-mediated synapse pruning	ISS
GO:0150064	Process	Vertebrate eye-specific patterning	ISS
GO:1901216	Process	Positive regulation of neuron death	ISS
GO:1904151	Process	Positive regulation of microglial cell mediated cytotoxicity	ISS
GO:1905114	Process	Cell surface receptor signaling pathway involved in cell-cell signaling	ISS
GO:2000363	Process	Positive regulation of prostaglandin-E synthase activity	ISS

Other IDs

• MIM: 120980
• HGNC: 6149
• e!Ensembl: ENSG00000169896

Protein

• UniProt ID: P11215
• Protein name: Integrin alpha-M (CD11 antigen-like family member B) (CR-3 alpha chain) (Cell surface glycoprotein MAC-1 subunit alpha) (Leukocyte adhesion receptor MO1) (Neutrophil adherence receptor) (CD antigen CD11b)
• Protein function: Integrin ITGAM/ITGB2 is implicated in various adhesive interactions of monocytes, macrophages and granulocytes as well as in mediating the uptake of complement-coated particles and pathogens (PubMed:20008295, PubMed:9558116). It is identical wit
• PDB: 1BHO, 1BHQ, 1IDN, 1IDO, 1JLM, 1M1U, 1MF7, 1N9Z, 1NA5, 2LKE, 2LKJ, 3Q3G, 3QA3, 4M76, 4XW2, 6RHW, 7AKK, 7P2D, 7USL, 7USM, 8CE6, 8CE9, 8VOH, 8VOI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00092	VWA	150 → 327	von Willebrand factor type A domain	Domain
  PF01839	FG-GAP	520 → 555	FG-GAP repeat	Repeat
  PF08441	Integrin_alpha2	614 → 1005	Integrin alpha	Family
  PF00357	Integrin_alpha	1129 → 1143	Integrin alpha cytoplasmic region	Family

• Sequence:

  MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQR
  GSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVK
  GLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQL
  KKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFN
  ITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQEL
  NTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEMSQEGFSAAIT
  SNGPLLSTVGSYDWAGGVFLYTSKEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLV
  LGAPRYQHIGLVAMFRQNTGMWESNANVKGTQIGAYFGASLCSVDVDSNGSTDLVLIGAP
  HYYEQTRGGQVSVCPLPRGRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAI
  GAPGEEDNRGAVYLFHGTSGSGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVD
  LTVGAQGHVLLLRSQPVLRVKAIMEFNPREVARNVFECNDQVVKGKEAGEVRVCLHVQKS
  TRDRLREGQIQSVVTYDLALDSGRPHSRAVFNETKNSTRRQTQVLGLTQTCETLKLQLPN
  CIEDPVSPIVLRLNFSLVGTPLSAFGNLRPVLAEDAQRLFTALFPFEKNCGNDNICQDDL
  SITFSFMSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLDLSYRKVSTLQNQRSQ
  RSWRLACESASSTEVSGALKSTSCSINHPIFPENSEVTFNITFDVDSKASLGNKLLLKAN
  VTSENNMPRTNKTEFQLELPVKYAVYMVVTSHGVSTKYLNFTASENTSRVMQHQYQVSNL
  GQRSLPISLVFLVPVRLNQTVIWDRPQVTFSENLSSTCHTKERLPSHSDFLAELRKAPVV
  NCSIAVCQRIQCDIPFFGIQEEFNATLKGNLSFDWYIKTSHNHLLIVSTAEILFNDSVFT
  LLPGQGAFVRSQTETKVEPFEVPNPLPLIVGSSVGGLLLLALITAALYKLGFFKRQYKDM
  MSEGGPPGAEPQ

• Sequence length: 1152