IRS2 (insulin receptor substrate 2)

Gene

• Entrez ID: 8660
• Gene name: Insulin receptor substrate 2
• Gene symbol: IRS2
• Synonyms: IRS-2
• Chromosome: 13
• Chromosome location: 13q34
• Summary: This gene encodes the insulin receptor substrate 2, a cytoplasmic signaling molecule that mediates effects of insulin, insulin-like growth factor 1, and other cytokines by acting as a molecular adaptor between diverse receptor tyrosine kinases and downstream effectors. The product of this gene is phosphorylated by the insulin receptor tyrosine kinase upon receptor stimulation, as well as by an interleukin 4 receptor-associated kinase in response to IL4 treatment. [provided by RefSeq, Jul 2008]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1805097	C>G,T	Risk-factor	Coding sequence variant, missense variant
rs137852740	G>A,C	Risk-factor	Missense variant, synonymous variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003808	hsa-miR-7-5p	Reporter assay, Western blot, Reporter assay;Western blot	18483236
MIRT006332	hsa-miR-145-5p	Luciferase reporter assay	22431718
MIRT007355	hsa-miR-33a-5p	Immunofluorescence, Luciferase reporter assay, Western blot	23547260
MIRT016052	hsa-miR-374b-5p	Sequencing	20371350
MIRT027863	hsa-miR-98-5p	Microarray	19088304
MIRT041990	hsa-miR-484	CLASH	23622248
MIRT051561	hsa-let-7e-5p	CLASH	23622248
MIRT052219	hsa-let-7b-5p	CLASH	23622248
MIRT052219	hsa-let-7b-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24810113
MIRT248936	hsa-miR-4501	HITS-CLIP	23313552
MIRT437827	hsa-miR-135a-5p	Luciferase reporter assay	23579070
MIRT702666	hsa-miR-489-3p	HITS-CLIP	23313552
MIRT702667	hsa-miR-542-3p	HITS-CLIP	23313552
MIRT702668	hsa-miR-4504	HITS-CLIP	23313552
MIRT702669	hsa-miR-3913-3p	HITS-CLIP	23313552
MIRT702670	hsa-miR-4299	HITS-CLIP	23313552
MIRT702671	hsa-miR-6719-3p	HITS-CLIP	23313552
MIRT702672	hsa-miR-4526	HITS-CLIP	23313552
MIRT702673	hsa-miR-3660	HITS-CLIP	23313552
MIRT702674	hsa-miR-6730-3p	HITS-CLIP	23313552
MIRT702675	hsa-miR-3921	HITS-CLIP	23313552
MIRT702676	hsa-miR-4653-5p	HITS-CLIP	23313552
MIRT702677	hsa-miR-301b-5p	HITS-CLIP	23313552
MIRT702678	hsa-miR-301a-5p	HITS-CLIP	23313552
MIRT702679	hsa-miR-146a-3p	HITS-CLIP	23313552
MIRT702680	hsa-miR-3607-5p	HITS-CLIP	23313552
MIRT702681	hsa-miR-4793-5p	HITS-CLIP	23313552
MIRT732366	hsa-miR-338-3p	Luciferase reporter assay, qRT-PCR, Western blot	28123847

Transcription factors

Transcription factor	Regulation	Reference
DLX5	Activation	21045156
EIF2AK2	Unknown	20685959
FOXO1	Unknown	20685959
NFIC	Activation	19755487
PGR	Unknown	14534541
SP1	Activation	19755487
SP1	Unknown	19875459
SREBF1	Repression	15881188;16091421
ZNF148	Unknown	19875459

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	IEA
GO:0002903	Process	Negative regulation of B cell apoptotic process	ISS
GO:0005158	Function	Insulin receptor binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	15161933, 17901049, 21241768, 23617393, 26496610, 28514442
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0006006	Process	Glucose metabolic process	TAS	9495343
GO:0007165	Process	Signal transduction	TAS	7675087
GO:0007411	Process	Axon guidance	TAS
GO:0007420	Process	Brain development	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	NAS	17925406
GO:0008286	Process	Insulin receptor signaling pathway	IBA	21873635
GO:0008286	Process	Insulin receptor signaling pathway	ISS
GO:0009749	Process	Response to glucose	ISS
GO:0010748	Process	Negative regulation of long-chain fatty acid import across plasma membrane	IMP	16814735
GO:0010907	Process	Positive regulation of glucose metabolic process	IMP	16814735
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	TAS
GO:0019216	Process	Regulation of lipid metabolic process	TAS	16814735
GO:0019901	Function	Protein kinase binding	IEA
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030879	Process	Mammary gland development	IEA
GO:0030890	Process	Positive regulation of B cell proliferation	ISS
GO:0032000	Process	Positive regulation of fatty acid beta-oxidation	IMP	16814735
GO:0032024	Process	Positive regulation of insulin secretion	ISS
GO:0032869	Process	Cellular response to insulin stimulus	IMP	16814735
GO:0032991	Component	Protein-containing complex	IEA
GO:0033673	Process	Negative regulation of kinase activity	ISS
GO:0038111	Process	Interleukin-7-mediated signaling pathway	TAS
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IBA	21873635
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	IMP	16814735
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	NAS	17925406
GO:0046326	Process	Positive regulation of glucose import	IMP	16814735
GO:0046579	Process	Positive regulation of Ras protein signal transduction	TAS
GO:0048015	Process	Phosphatidylinositol-mediated signaling	TAS
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0055088	Process	Lipid homeostasis	TAS	16814735
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071889	Function	14-3-3 protein binding	IEA

Other IDs

• MIM: 600797
• HGNC: 6126
• e!Ensembl: ENSG00000185950

Protein

• UniProt ID: Q9Y4H2
• Protein name: Insulin receptor substrate 2 (IRS-2)
• Protein function: May mediate the control of various cellular processes by insulin.
• PDB: 3FQW, 3FQX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00169	PH	31 → 144	PH domain	Domain
  PF02174	IRS	194 → 296	PTB domain (IRS-1 type)	Domain

• Sequence:

  MASPPRHGPPGPASGDGPNLNNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGAGGDEA
  TAGGGSAPQPPRLEYYESEKKWRSKAGAPKRVIALDCCLNINKRADAKHKYLIALYTKDE
  YFAVAAENEQEQEGWYRALTDLVSEGRAAAGDAPPAAAPAASCSASLPGALGGSAGAAGA
  EDSYGLVAPATAAYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTL
  QLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEF
  RPRSKSQSSGSSATHPISVPGARRHHHLVNLPPSQTGLVRRSRTDSLAATPPAAKCSSCR
  VRTASEGDGGAAAGAAAAGARPVSVAGSPLSPGPVRAPLSRSHTLSGGCGGRGSKVALLP
  AGGALQHSRSMSMPVAHSPPAATSPGSLSSSSGHGSGSYPPPPGPHPPLPHPLHHGPGQR
  PSSGSASASGSPSDPGFMSLDEYGSSPGDLRAFCSHRSNTPESIAETPPARDGGGGGEFY
  GYMTMDRPLSHCGRSYRRVSGDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTL
  MRATFSGSAGRLCPSCPASSPKVAYHPYPEDYGDIEIGSHRSSSSNLGADDGYMPMTPGA
  ALAGSGSGSCRSDDYMPMSPASVSAPKQILQPRAAAAAAAAVPSAGPAGPAPTSAAGRTF
  PASGGGYKASSPAESSPEDSGYMRMWCGSKLSMEHADGKLLPNGDYLNVSPSDAVTTGTP
  PDFFSAALHPGGEPLRGVPGCCYSSLPRSYKAPYTCGGDSDQYVLMSSPVGRILEEERLE
  PQATPGPSQAASAFGAGPTQPPHPVVPSPVRPSGGRPEGFLGQRGRAVRPTRLSLEGLPS
  LPSMHEYPLPPEPKSPGEYINIDFGEPGARLSPPAPPLLASAASSSSLLSASSPASSLGS
  GTPGTSSDSRQRSPLSDYMNLDFSSPKSPKPGAPSGHPVGSLDGLLSPEASSPYPPLPPR
  PSASPSSSLQPPPPPPAPGELYRLPPASAVATAQGPGAASSLSSDTGDNGDYTEMAFGVA
  ATPPQPIAAPPKPEAARVASPTSGVKRLSLMEQVSGVEAFLQASQPPDPHRGAKVIRADP
  QGGRRRHSSETFSSTTTVTPVSPSFAHNPKRHNSASVENVSLRKSSEGGVGVGPGGGDEP
  PTSPRQLQPAPPLAPQGRPWTPGQPGGLVGCPGSGGSPMRRETSAGFQNGLNYIAIDVRE
  EPGLPPQPQPPPPPLPQPGDKSSWGRTRSLGGLISAVGVGSTGGGCGGPGPGALPPANTY
  ASIDFLSHHLKEATIVKE

• Sequence length: 1338