IQGAP1 (IQ motif containing GTPase activating protein 1)

Gene

• Entrez ID: 8826
• Gene name: IQ motif containing GTPase activating protein 1
• Gene symbol: IQGAP1
• Synonyms: HUMORFA01, SAR1, p195
• Chromosome: 15
• Chromosome location: 15q26.1
• Summary: This gene encodes a member of the IQGAP family. The protein contains four IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. Expression of the protein is upregulated by gene amplification in two gastric cancer cell lines. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002697	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	19843643
MIRT002697	hsa-miR-124-3p	Luciferase reporter assay, Microarray	15685193
MIRT002697	hsa-miR-124-3p	Immunoblot, Immunohistochemistry, qRT-PCR, Western blot	21196113
MIRT002697	hsa-miR-124-3p	Microarray	18668037
MIRT002697	hsa-miR-124-3p	Luciferase reporter assay	26934121
MIRT024313	hsa-miR-215-5p	Microarray	19074876
MIRT026798	hsa-miR-192-5p	Microarray	19074876
MIRT042850	hsa-miR-324-3p	CLASH	23622248
MIRT049578	hsa-miR-92a-3p	CLASH	23622248
MIRT440432	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT440433	hsa-miR-544a	HITS-CLIP	24374217
MIRT724396	hsa-miR-136-3p	HITS-CLIP	19536157
MIRT724397	hsa-miR-3074-3p	HITS-CLIP	19536157
MIRT724398	hsa-miR-449b-3p	HITS-CLIP	19536157
MIRT733787	hsa-miR-506-3p	Luciferase reporter assay, qRT-PCR, Western blot	26398880
MIRT734339	hsa-miR-506-5p	Luciferase reporter assay, qRT-PCR, Western blot	26398880

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IDA	25554515, 26242911
GO:0005078	Function	MAP-kinase scaffold activity	IPI	18567582
GO:0005095	Function	GTPase inhibitor activity	TAS	8670801
GO:0005096	Function	GTPase activator activity	IBA	21873635
GO:0005509	Function	Calcium ion binding	IDA	18567582
GO:0005515	Function	Protein binding	IPI	10793131, 12745076, 17563371, 17620407, 17853893, 18809683, 20875083, 21349850, 21724847, 21876773, 22662192, 23333244, 23982733, 25074804, 25554515, 26242911, 26496610, 27173435, 28007913, 29033352, 31980649, 32296183
GO:0005516	Function	Calmodulin binding	IBA	21873635
GO:0005516	Function	Calmodulin binding	IDA	18567582
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IDA	22493426
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	20883816, 29033352
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	25554515, 29033352
GO:0005829	Component	Cytosol	TAS
GO:0005874	Component	Microtubule	IDA	21525035
GO:0005884	Component	Actin filament	TAS	8670801
GO:0005886	Component	Plasma membrane	IDA	29033352
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007165	Process	Signal transduction	TAS	8051149
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IMP	17563371, 18567582
GO:0007346	Process	Regulation of mitotic cell cycle	IMP	20883816
GO:0015629	Component	Actin cytoskeleton	ISS
GO:0015630	Component	Microtubule cytoskeleton	ISS
GO:0016032	Process	Viral process	IEA
GO:0016477	Process	Cell migration	IMP	26242911
GO:0019901	Function	Protein kinase binding	IPI	17563371, 18567582
GO:0019903	Function	Protein phosphatase binding	IPI	16380380
GO:0019904	Function	Protein domain specific binding	IPI	25554515
GO:0030424	Component	Axon	ISS
GO:0030426	Component	Growth cone	ISS
GO:0030496	Component	Midbody	IDA	15166316
GO:0030667	Component	Secretory granule membrane	TAS
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IDA	22493426
GO:0031267	Function	Small GTPase binding	IPI	26242911
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA	21873635
GO:0032991	Component	Protein-containing complex	IEA
GO:0034260	Process	Negative regulation of GTPase activity	IEA
GO:0036057	Component	Slit diaphragm	ISS
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA	15121898
GO:0043005	Component	Neuron projection	ISS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043406	Process	Positive regulation of MAP kinase activity	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	18567582
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	17563371
GO:0043547	Process	Positive regulation of GTPase activity	IEA
GO:0044548	Function	S100 protein binding	IPI	25554515
GO:0045121	Component	Membrane raft	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045860	Process	Positive regulation of protein kinase activity	IMP	17563371
GO:0051015	Function	Actin filament binding	IBA	21873635
GO:0051019	Function	Mitogen-activated protein kinase binding	IEA
GO:0051894	Process	Positive regulation of focal adhesion assembly	IEA
GO:0060090	Function	Molecular adaptor activity	IDA	26242911
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337, 23533145
GO:0071277	Process	Cellular response to calcium ion	IDA	18567582
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IMP	17563371, 26242911
GO:0072015	Process	Glomerular visceral epithelial cell development	ISS
GO:1900006	Process	Positive regulation of dendrite development	IEA
GO:1900086	Process	Positive regulation of peptidyl-tyrosine autophosphorylation	IEA
GO:1903829	Process	Positive regulation of cellular protein localization	IEA
GO:1904754	Process	Positive regulation of vascular associated smooth muscle cell migration	IEA
GO:1990138	Process	Neuron projection extension	IMP	15695813
GO:1990776	Process	Response to angiotensin	IEA

Other IDs

• MIM: 603379
• HGNC: 6110
• e!Ensembl: ENSG00000140575

Protein

• UniProt ID: P46940
• Protein name: Ras GTPase-activating-like protein IQGAP1 (p195)
• Protein function: Plays a crucial role in regulating the dynamics and assembly of the actin cytoskeleton. Binds to activated CDC42 but does not stimulate its GTPase activity. It associates with calmodulin. Could serve as an assembly scaffold for the organization of a multimolecular complex that would interface incoming signals to the reorganization of the actin cytoskeleton at the plasma membrane. May promote neurite outgrowth (PubMed:15695813). May play a possible role in cell cycle regulation by contributing to cell cycle progression after DNA replication arrest (PubMed:20883816).
• PDB: 1X0H, 2RR8, 3FAY, 3I6X, 5L0O
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00307	CH	44 → 161	Calponin homology (CH) domain	Domain
  PF00612	IQ	747 → 766	IQ calmodulin-binding motif	Motif
  PF00612	IQ	776 → 796	IQ calmodulin-binding motif	Motif
  PF00612	IQ	806 → 826	IQ calmodulin-binding motif	Motif
  PF00612	IQ	837 → 856	IQ calmodulin-binding motif	Motif
  PF00616	RasGAP	1025 → 1237	GTPase-activator protein for Ras-like GTPase	Family
  PF03836	RasGAP_C	1452 → 1580	RasGAP C-terminus	Family

• Sequence:

  MSAADEVDGLGVARPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGE
  DLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWL
  NAMDEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEE
  EINNMKTELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDRRIPADTFAAL
  KNPNAMLVNLEEPLASTYQDILYQAKQDKMTNAKNRTENSERERDVYEELLTQAEIQGNI
  NKVNTFSALANIDLALEQGDALALFRALQSPALGLRGLQQQNSDWYLKQLLSDKQQKRQS
  GQTDPLQKEELQSGVDAANSAAQQYQRRLAAVALINAAIQKGVAEKTVLELMNPEAQLPQ
  VYPFAADLYQKELATLQRQSPEHNLTHPELSVAVEMLSSVALINRALESGDVNTVWKQLS
  SSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERIL
  AIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAV
  LWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPEC
  GETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQL
  SREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAIT
  CIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRDRLQYFRDHINDII
  KIQAFIRANKARDDYKTLINAEDPPMVVVRKFVHLLDQSDQDFQEELDLMKMREEVITLI
  RSNQQLENDLNLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMINKQKGGLKA
  LSKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEY
  LLLRLFKTALQEEIKSKVDQIQEIVTGNPTVIKMVVSFNRGARGQNALRQILAPVVKEIM
  DDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQALAHEEVKTRLDSSIRNMRA
  VTDKFLSAIVSSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGNLLYYRYMNPAI
  VAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQ
  KFRRFFQTACDVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEH
  NDPIHELLDDLGEVPTIESLIGESSGNLNDPNKEALAKTEVSLTLTNKFDVPGDENAEMD
  ARTILLNTKRLIVDVIRFQPGETLTEILETPATSEQEAEHQRAMQRRAIRDAKTPDKMKK
  SKSVKEDSNLTLQEKKEKIQTGLKKLTELGTVDPKNKYQELINDIARDIRNQRRYRQRRK
  AELVKLQQTYAALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKIS
  LKYTAARLHEKGVLLEIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGVQMETFMLHYQ
  DLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK

• Sequence length: 1657