IL3 (interleukin 3)

Gene

• Entrez ID: 3562
• Gene name: Interleukin 3
• Gene symbol: IL3
• Synonyms: IL-3, MCGF, MULTI-CSF
• Chromosome: 5
• Chromosome location: 5q31.1
• Summary: The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029305	hsa-miR-26b-5p	Microarray	19088304
MIRT053457	hsa-miR-452-5p	Microarray	23807165
MIRT732910	hsa-miR-155-3p	qRT-PCR	28301819

Transcription factors

Transcription factor	Regulation	Reference
CEBPA	Unknown	10453008
CEBPB	Unknown	10453008
DNMT1	Repression	15735013
EGR1	Activation	8035792
ETS1	Unknown	8704203
JUN	Activation	7642615
JUNB	Unknown	8704203
JUND	Unknown	8704203
RUNX1	Repression	15735013
RUNX1T1	Unknown	15735013
SP1	Unknown	8454603
VEZF1	Activation	8035792

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0001959	Process	Regulation of cytokine-mediated signaling pathway	TAS
GO:0005125	Function	Cytokine activity	IEA
GO:0005135	Function	Interleukin-3 receptor binding	TAS	2544122
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	ISS
GO:0006955	Process	Immune response	IEA
GO:0007267	Process	Cell-cell signaling	TAS	3497400
GO:0007399	Process	Nervous system development	TAS	9736740
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	9722506
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0035162	Process	Embryonic hemopoiesis	IDA	21149635
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	9722506
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	ISS

Other IDs

• MIM: 147740
• HGNC: 6011
• e!Ensembl: ENSG00000164399

Protein

• UniProt ID: P08700
• Protein name: Interleukin-3 (IL-3) (Hematopoietic growth factor) (Mast cell growth factor) (MCGF) (Multipotential colony-stimulating factor) (P-cell-stimulating factor)
• Protein function: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
• PDB: 1JLI, 5UV8, 5UWC, 6NMY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02059	IL3	20 → 137	Interleukin-3	Domain

• Sequence:

  MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLN
  GEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKD
  GDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

• Sequence length: 152