GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

IL1B (interleukin 1 beta)

Gene

3553

Interleukin 1 beta

IL1B

IL-1, IL1-BETA, IL1F2, IL1beta

2q14.1

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an impo

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1143627	G>A	Risk-factor	5 prime UTR variant, upstream transcript variant, genic upstream transcript variant

Show/Hide all(132)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005830	hsa-miR-204-5p	Microarray	21282569
MIRT005951	hsa-miR-21-5p	Luciferase reporter assay, Microarray, qRT-PCR	21131358
MIRT733144	hsa-miR-155-5p	qRT-PCR	31766503
MIRT733149	hsa-miR-34a-5p	qRT-PCR	31766503
MIRT733150	hsa-let-7c-5p	qRT-PCR	31766503
MIRT734896	hsa-miR-362-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33459949
MIRT735074	hsa-miR-221-5p	Luciferase reporter assay, qRT-PCR, ELISA	33201565
MIRT735665	hsa-miR-340-5p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	32712318
MIRT733150	hsa-let-7c-5p	qRT-PCR	34198264
MIRT735818	hsa-miR-149-5p	qRT-PCR	34198264
MIRT735818	hsa-miR-149-5p	qRT-PCR	36250208
MIRT755648	hsa-miR-124-3p	Luciferase reporter assay, Western blotting, qRT-PCR	38146363
MIRT755847	hsa-miR-105-5p	qRT-PCR	34824551
MIRT1064204	hsa-miR-3682-5p	CLIP-seq
MIRT2247568	hsa-miR-3942-3p	CLIP-seq
MIRT2247569	hsa-miR-4670-3p	CLIP-seq
MIRT2247570	hsa-miR-4683	CLIP-seq
MIRT2437793	hsa-miR-124	CLIP-seq
MIRT2437794	hsa-miR-1256	CLIP-seq
MIRT2437795	hsa-miR-185	CLIP-seq
MIRT2437796	hsa-miR-2682	CLIP-seq
MIRT2437797	hsa-miR-3064-5p	CLIP-seq
MIRT2437798	hsa-miR-3134	CLIP-seq
MIRT2437799	hsa-miR-3147	CLIP-seq
MIRT2437800	hsa-miR-3160-3p	CLIP-seq
MIRT1064204	hsa-miR-3682-5p	CLIP-seq
MIRT2437801	hsa-miR-3684	CLIP-seq
MIRT2437802	hsa-miR-3714	CLIP-seq
MIRT2437803	hsa-miR-3910	CLIP-seq
MIRT2437804	hsa-miR-3945	CLIP-seq
MIRT2437805	hsa-miR-4253	CLIP-seq
MIRT2437806	hsa-miR-4259	CLIP-seq
MIRT2437807	hsa-miR-4306	CLIP-seq
MIRT2437808	hsa-miR-4313	CLIP-seq
MIRT2437809	hsa-miR-4428	CLIP-seq
MIRT2437810	hsa-miR-449c	CLIP-seq
MIRT2437811	hsa-miR-4514	CLIP-seq
MIRT2437812	hsa-miR-4520a-3p	CLIP-seq
MIRT2437813	hsa-miR-4534	CLIP-seq
MIRT2437814	hsa-miR-4644	CLIP-seq
MIRT2247570	hsa-miR-4683	CLIP-seq
MIRT2437815	hsa-miR-4692	CLIP-seq
MIRT2437816	hsa-miR-4766-5p	CLIP-seq
MIRT2437817	hsa-miR-4768-3p	CLIP-seq
MIRT2437818	hsa-miR-488	CLIP-seq
MIRT2437819	hsa-miR-506	CLIP-seq
MIRT2437820	hsa-miR-940	CLIP-seq
MIRT2437821	hsa-miR-943	CLIP-seq
MIRT2550936	hsa-miR-1178	CLIP-seq
MIRT2437793	hsa-miR-124	CLIP-seq
MIRT2437794	hsa-miR-1256	CLIP-seq
MIRT2550937	hsa-miR-1291	CLIP-seq
MIRT2550938	hsa-miR-149	CLIP-seq
MIRT2437795	hsa-miR-185	CLIP-seq
MIRT2550939	hsa-miR-24	CLIP-seq
MIRT2437796	hsa-miR-2682	CLIP-seq
MIRT2550940	hsa-miR-299-3p	CLIP-seq
MIRT2437797	hsa-miR-3064-5p	CLIP-seq
MIRT2550941	hsa-miR-3065-5p	CLIP-seq
MIRT2550942	hsa-miR-3121-3p	CLIP-seq
MIRT2437798	hsa-miR-3134	CLIP-seq
MIRT2437799	hsa-miR-3147	CLIP-seq
MIRT2437800	hsa-miR-3160-3p	CLIP-seq
MIRT2550943	hsa-miR-3174	CLIP-seq
MIRT2550944	hsa-miR-328	CLIP-seq
MIRT1064204	hsa-miR-3682-5p	CLIP-seq
MIRT2437801	hsa-miR-3684	CLIP-seq
MIRT2437802	hsa-miR-3714	CLIP-seq
MIRT2437803	hsa-miR-3910	CLIP-seq
MIRT2550945	hsa-miR-3937	CLIP-seq
MIRT2437804	hsa-miR-3945	CLIP-seq
MIRT2437805	hsa-miR-4253	CLIP-seq
MIRT2437806	hsa-miR-4259	CLIP-seq
MIRT2550946	hsa-miR-4284	CLIP-seq
MIRT2550947	hsa-miR-4300	CLIP-seq
MIRT2437807	hsa-miR-4306	CLIP-seq
MIRT2437808	hsa-miR-4313	CLIP-seq
MIRT2437809	hsa-miR-4428	CLIP-seq
MIRT2550948	hsa-miR-4446-3p	CLIP-seq
MIRT2550949	hsa-miR-4450	CLIP-seq
MIRT2550950	hsa-miR-4492	CLIP-seq
MIRT2550951	hsa-miR-4498	CLIP-seq
MIRT2437810	hsa-miR-449c	CLIP-seq
MIRT2550952	hsa-miR-4505	CLIP-seq
MIRT2437811	hsa-miR-4514	CLIP-seq
MIRT2437812	hsa-miR-4520a-3p	CLIP-seq
MIRT2437813	hsa-miR-4534	CLIP-seq
MIRT2437814	hsa-miR-4644	CLIP-seq
MIRT2550953	hsa-miR-4645-5p	CLIP-seq
MIRT2550954	hsa-miR-4648	CLIP-seq
MIRT2550955	hsa-miR-4652-3p	CLIP-seq
MIRT2550956	hsa-miR-4654	CLIP-seq
MIRT2550957	hsa-miR-4667-5p	CLIP-seq
MIRT2550958	hsa-miR-4673	CLIP-seq
MIRT2247570	hsa-miR-4683	CLIP-seq
MIRT2437815	hsa-miR-4692	CLIP-seq
MIRT2550959	hsa-miR-4700-5p	CLIP-seq
MIRT2550960	hsa-miR-4731-5p	CLIP-seq
MIRT2437816	hsa-miR-4766-5p	CLIP-seq
MIRT2437817	hsa-miR-4768-3p	CLIP-seq
MIRT2550961	hsa-miR-4769-5p	CLIP-seq
MIRT2437818	hsa-miR-488	CLIP-seq
MIRT2550962	hsa-miR-495	CLIP-seq
MIRT2437819	hsa-miR-506	CLIP-seq
MIRT2550963	hsa-miR-663b	CLIP-seq
MIRT2550964	hsa-miR-762	CLIP-seq
MIRT2550965	hsa-miR-920	CLIP-seq
MIRT2437820	hsa-miR-940	CLIP-seq
MIRT2437821	hsa-miR-943	CLIP-seq
MIRT2550937	hsa-miR-1291	CLIP-seq
MIRT2550938	hsa-miR-149	CLIP-seq
MIRT2550939	hsa-miR-24	CLIP-seq
MIRT2550941	hsa-miR-3065-5p	CLIP-seq
MIRT2550943	hsa-miR-3174	CLIP-seq
MIRT2550944	hsa-miR-328	CLIP-seq
MIRT1064204	hsa-miR-3682-5p	CLIP-seq
MIRT2437801	hsa-miR-3684	CLIP-seq
MIRT2550945	hsa-miR-3937	CLIP-seq
MIRT2550946	hsa-miR-4284	CLIP-seq
MIRT2437808	hsa-miR-4313	CLIP-seq
MIRT2550948	hsa-miR-4446-3p	CLIP-seq
MIRT2550949	hsa-miR-4450	CLIP-seq
MIRT2550950	hsa-miR-4492	CLIP-seq
MIRT2550951	hsa-miR-4498	CLIP-seq
MIRT2550952	hsa-miR-4505	CLIP-seq
MIRT2550955	hsa-miR-4652-3p	CLIP-seq
MIRT2550957	hsa-miR-4667-5p	CLIP-seq
MIRT2550959	hsa-miR-4700-5p	CLIP-seq
MIRT2550960	hsa-miR-4731-5p	CLIP-seq
MIRT2550962	hsa-miR-495	CLIP-seq
MIRT2550963	hsa-miR-663b	CLIP-seq
MIRT2550964	hsa-miR-762	CLIP-seq

Transcription factors

Show/Hide all(23)

Transcription factor	Regulation	Reference
AHR	Unknown	23349129
CEBPB	Activation	17386941
CEBPB	Unknown	10383163;10801783
E2F1	Unknown	17707233
HMGA1	Unknown	15901130
HSF1	Repression	10328874
IRF8	Activation	17386941
JUN	Unknown	11306276
JUNB	Unknown	11306276
KLF4	Repression	22449968
NFIL3	Repression	8547328
NFKB1	Activation	12686724;14960579;8413223;8679226;9878621
NFKB1	Unknown	10080875;10963848;16433741;17707233;18285351;20336759;9058643
NFKBIA	Repression	15228586
REL	Activation	8413223
RELA	Activation	12686724;14960579;8021507;8413223;8679226;9878621
RELA	Unknown	10080875;10963848;16433741;17707233;18285351;20336759;9058643
SIRT1	Unknown	21245135
SPI1	Activation	17386941
SPI1	Unknown	10801783
STAT1	Activation	17386941
SUGP1	Activation	9878621
YY1	Unknown	22467534

Show/Hide all(116)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IMP	21147091
GO:0000187	Process	Activation of MAPK activity	IDA	10748004
GO:0001660	Process	Fever generation	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	10748004
GO:0001934	Process	Positive regulation of protein phosphorylation	NAS	16477012
GO:0002711	Process	Positive regulation of T cell mediated immunity	IC	1919436
GO:0005125	Function	Cytokine activity	IDA	1919436
GO:0005125	Function	Cytokine activity	IMP	2989698
GO:0005125	Function	Cytokine activity	TAS	28720735
GO:0005149	Function	Interleukin-1 receptor binding	NAS	1919436
GO:0005178	Function	Integrin binding	IDA	29030430
GO:0005515	Function	Protein binding	IPI	15817483, 32272059
GO:0005576	Component	Extracellular region	IDA	20041150
GO:0005576	Component	Extracellular region	NAS	1919436
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	12483741
GO:0005615	Component	Extracellular space	IMP	3493774
GO:0005764	Component	Lysosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	TAS	9218611
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006954	Process	Inflammatory response	IDA	10748004, 21147091
GO:0006954	Process	Inflammatory response	NAS	1919436
GO:0006954	Process	Inflammatory response	TAS	28720735
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	9218611, 10786823
GO:0007267	Process	Cell-cell signaling	TAS	2989698
GO:0007566	Process	Embryo implantation	TAS	16720713
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	25204733
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	3493774
GO:0010573	Process	Vascular endothelial growth factor production	IDA	12794819
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IDA	12958148
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	ISS
GO:0010628	Process	Positive regulation of gene expression	IBA	21873635
GO:0010628	Process	Positive regulation of gene expression	IDA	11090614, 21559518, 23817958, 25327529, 26687115, 29384235
GO:0010628	Process	Positive regulation of gene expression	IGI	29384235
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IDA	25204733
GO:0010829	Process	Negative regulation of glucose transmembrane transport	ISS	16865359
GO:0014805	Process	Smooth muscle adaptation	NAS	16477012
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	10748004
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019904	Function	Protein domain specific binding	IPI	16575408
GO:0030213	Process	Hyaluronan biosynthetic process	IDA	15100360
GO:0030335	Process	Positive regulation of cell migration	IDA	25204733
GO:0030730	Process	Sequestering of triglyceride	IDA	19032770
GO:0030949	Process	Positive regulation of vascular endothelial growth factor receptor signaling pathway	IC	12958148
GO:0031394	Process	Positive regulation of prostaglandin biosynthetic process	IGI	29384235
GO:0031622	Process	Positive regulation of fever generation	ISS
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IDA	21147091
GO:0032308	Process	Positive regulation of prostaglandin secretion	ISS
GO:0032496	Process	Response to lipopolysaccharide	IDA	19193853
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	20027291
GO:0032729	Process	Positive regulation of interferon-gamma production	IDA	10653850, 20027291
GO:0032743	Process	Positive regulation of interleukin-2 production	IMP	2989698
GO:0032755	Process	Positive regulation of interleukin-6 production	IGI	29384235
GO:0032755	Process	Positive regulation of interleukin-6 production	TAS	16865359
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	19524870
GO:0033092	Process	Positive regulation of immature T cell proliferation in thymus	IBA	21873635
GO:0033129	Process	Positive regulation of histone phosphorylation	NAS	20018936
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	IDA	15100360
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	NAS	19281832
GO:0035066	Process	Positive regulation of histone acetylation	NAS	20018936
GO:0035505	Process	Positive regulation of myosin light chain kinase activity	IDA	18390750
GO:0035690	Process	Cellular response to drug	IDA	19158679
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	1919436
GO:0043122	Process	Regulation of I-kappaB kinase/NF-kappaB signaling	IDA	10748004
GO:0043407	Process	Negative regulation of MAP kinase activity	ISS	16865359
GO:0043491	Process	Protein kinase B signaling	IMP	21147091
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IDA	8383325
GO:0045766	Process	Positive regulation of angiogenesis	IDA	25204733
GO:0045766	Process	Positive regulation of angiogenesis	ISS
GO:0045833	Process	Negative regulation of lipid metabolic process	ISS	16865359
GO:0045840	Process	Positive regulation of mitotic nuclear division	IMP	2989698
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	15100360
GO:0045917	Process	Positive regulation of complement activation	IGI	29384235
GO:0046330	Process	Positive regulation of JNK cascade	ISS
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	ISS	16865359
GO:0046827	Process	Positive regulation of protein export from nucleus	NAS	19281832
GO:0050729	Process	Positive regulation of inflammatory response	IGI	29384235
GO:0050766	Process	Positive regulation of phagocytosis	IMP	18201371
GO:0050767	Process	Regulation of neurogenesis	ISS
GO:0050768	Process	Negative regulation of neurogenesis	TAS	20018408
GO:0050796	Process	Regulation of insulin secretion	IDA	8383325
GO:0050805	Process	Negative regulation of synaptic transmission	ISS
GO:0050995	Process	Negative regulation of lipid catabolic process	IDA	19032770
GO:0050996	Process	Positive regulation of lipid catabolic process	ISS	16865359
GO:0050999	Process	Regulation of nitric-oxide synthase activity	IBA	21873635
GO:0050999	Process	Regulation of nitric-oxide synthase activity	IDA	15899045
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IDA	18373975
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	10748004
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	10383454, 12958148, 25327529
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0060252	Process	Positive regulation of glial cell proliferation	IGI	1752215
GO:0060355	Process	Positive regulation of cell adhesion molecule production	NAS	19281832
GO:0060559	Process	Positive regulation of calcidiol 1-monooxygenase activity	IDA	16720713, 17023519
GO:0070164	Process	Negative regulation of adiponectin secretion	ISS	16865359
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IDA	25204733
GO:0070487	Process	Monocyte aggregation	IDA	15100360
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IDA	25327529
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0070555	Process	Response to interleukin-1	IDA	29441883
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA	21873635
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071310	Process	Cellular response to organic substance	IDA	19158679
GO:0071407	Process	Cellular response to organic cyclic compound	IDA	21147091
GO:0071639	Process	Positive regulation of monocyte chemotactic protein-1 production	IDA	19524870
GO:0150078	Process	Positive regulation of neuroinflammatory response	TAS	26753638
GO:1900745	Process	Positive regulation of p38MAPK cascade	ISS
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	IDA	18390750
GO:1902680	Process	Positive regulation of RNA biosynthetic process	IDA	29384235
GO:1903140	Process	Regulation of establishment of endothelial barrier	IDA	25816133
GO:1903597	Process	Negative regulation of gap junction assembly	IDA	11090614
GO:2000556	Process	Positive regulation of T-helper 1 cell cytokine production	IDA	10653850
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IDA	10748004

MIM	HGNC	e!Ensembl
147720	5992	ENSG00000125538

Protein

UniProt ID

P01584

Protein name

Interleukin-1 beta (IL-1 beta) (Catabolin)

Protein function

Potent pro-inflammatory cytokine (PubMed:10653850, PubMed:12794819, PubMed:28331908, PubMed:3920526). Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and

PDB

1HIB , 1I1B , 1IOB , 1ITB , 1L2H , 1S0L , 1T4Q , 1TOO , 1TP0 , 1TWE , 1TWM , 21BI , 2I1B , 2KH2 , 2NVH , 31BI , 3LTQ , 3O4O , 3POK , 41BI , 4DEP , 4G6J , 4G6M , 4GAF , 4GAI , 4I1B , 5BVP , 5I1B , 5MVZ , 5R7W , 5R85 , 5R86 , 5R87 , 5R88 , 5R89 , 5R8A , 5R8B , 5R8C , 5R8D , 5R8E , 5R8F , 5R8G , 5R8H , 5R8I , 5R8J , 5R8K , 5R8L , 5R8M , 5R8N , 5R8O , 5R8P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02394	IL1_propep	1 → 103	Interleukin-1 propeptide	Family
PF00340	IL1	147 → 264	Interleukin-1 / 18	Domain

Sequence

MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS

Sequence length

269

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412