IL1A (interleukin 1 alpha)

Gene

• Entrez ID: 3552
• Gene name: Interleukin 1 alpha
• Gene symbol: IL1A
• Synonyms: IL-1 alpha, IL-1A, IL1, IL1-ALPHA, IL1F1
• Chromosome: 2
• Chromosome location: 2q14.1
• Summary: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macropha

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004689	hsa-miR-191-5p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR	20924108
MIRT004689	hsa-miR-191-5p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR	20924108
MIRT017051	hsa-miR-335-5p	Microarray	18185580
MIRT054374	hsa-miR-142-3p	Luciferase reporter assay, Western blot	22870299
MIRT054374	hsa-miR-142-3p	Luciferase reporter assay, Western blot	22870299
MIRT727459	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT727458	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT727456	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT727457	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT727455	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT727454	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT727453	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT727451	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT727452	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT1064196	hsa-miR-1254	CLIP-seq
MIRT1064197	hsa-miR-3116	CLIP-seq
MIRT1064198	hsa-miR-3179	CLIP-seq
MIRT1064199	hsa-miR-3605-5p	CLIP-seq
MIRT1064200	hsa-miR-3936	CLIP-seq
MIRT1064201	hsa-miR-4257	CLIP-seq
MIRT1064202	hsa-miR-545	CLIP-seq
MIRT1064203	hsa-miR-661	CLIP-seq
MIRT2389362	hsa-miR-141	CLIP-seq
MIRT2389363	hsa-miR-200a	CLIP-seq
MIRT2437788	hsa-miR-132	CLIP-seq
MIRT2437789	hsa-miR-212	CLIP-seq
MIRT2437790	hsa-miR-3545-3p	CLIP-seq
MIRT2437791	hsa-miR-4778-3p	CLIP-seq
MIRT2437792	hsa-miR-4802-3p	CLIP-seq
MIRT2451720	hsa-miR-3619-3p	CLIP-seq
MIRT2451721	hsa-miR-4535	CLIP-seq
MIRT2451722	hsa-miR-4776-5p	CLIP-seq
MIRT2451723	hsa-miR-890	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOS	Unknown	8688489
JUN	Unknown	8688489
NFKB1	Repression	17612514
RELA	Repression	17612514

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001660	Process	Fever generation	IEA
GO:0001819	Process	Positive regulation of cytokine production	IDA	1739124
GO:0002248	Process	Connective tissue replacement involved in inflammatory response wound healing	IEA
GO:0005125	Function	Cytokine activity	IMP	2989698
GO:0005149	Function	Interleukin-1 receptor binding	IEA
GO:0005507	Function	Copper ion binding	IDA	12746488
GO:0005515	Function	Protein binding	IPI	12746488, 16971486, 18329368, 25241761, 25416956, 25910212
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	12746488
GO:0005615	Component	Extracellular space	IMP	3493774
GO:0005829	Component	Cytosol	IDA	12746488
GO:0006883	Process	Cellular sodium ion homeostasis	IEA
GO:0006915	Process	Apoptotic process	TAS	1924307
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006955	Process	Immune response	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	3493774
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	ISS
GO:0010628	Process	Positive regulation of gene expression	IBA	21873635
GO:0010628	Process	Positive regulation of gene expression	IDA	23817958
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	IMP	2989698
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0032743	Process	Positive regulation of interleukin-2 production	IMP	2989698
GO:0032743	Process	Positive regulation of interleukin-2 production	ISS	31172560
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS	31172560
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS	31172560
GO:0033092	Process	Positive regulation of immature T cell proliferation in thymus	IBA	21873635
GO:0034605	Process	Cellular response to heat	IDA	12746488
GO:0035234	Process	Ectopic germ cell programmed cell death	IEA
GO:0045766	Process	Positive regulation of angiogenesis	ISS
GO:0045840	Process	Positive regulation of mitotic nuclear division	IMP	2989698
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046688	Process	Response to copper ion	IDA	12746488
GO:0050714	Process	Positive regulation of protein secretion	IMP	9564845
GO:0050999	Process	Regulation of nitric-oxide synthase activity	IBA	21873635
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA	21873635
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	TAS	10748004

Other IDs

• MIM: 147760
• HGNC: 5991
• e!Ensembl: ENSG00000115008

Protein

• UniProt ID: P01583
• Protein name: Interleukin-1 alpha (IL-1 alpha) (Hematopoietin-1)
• Protein function: Cytokine constitutively present intracellularly in nearly all resting non-hematopoietic cells that plays an important role in inflammation and bridges the innate and adaptive immune systems (PubMed:26439902). After binding to its receptor IL1R1
• PDB: 2ILA, 2KKI, 2L5X, 5UC6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02394	IL1_propep	1 → 109	Interleukin-1 propeptide	Family
  PF00340	IL1	155 → 266	Interleukin-1 / 18	Domain

• Sequence:

  MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETS
  KTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLS
  NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKI
  TVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHP
  NLFIATKQDYWVCLAGGPPSITDFQILENQA

• Sequence length: 271