IL1A (interleukin 1 alpha)

Gene

• Entrez ID: 3552
• Gene name: Interleukin 1 alpha
• Gene symbol: IL1A
• Synonyms: IL-1 alpha, IL-1A, IL1, IL1-ALPHA, IL1F1
• Chromosome: 2
• Chromosome location: 2q14.1
• Summary: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer`s disease. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004689	hsa-miR-191-5p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR	20924108
MIRT017051	hsa-miR-335-5p	Microarray	18185580
MIRT054374	hsa-miR-142-3p	Luciferase reporter assay, Western blot	22870299
MIRT727451	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT727452	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT727453	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT727454	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT727455	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT727456	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT727457	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT727458	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT727459	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT733328	hsa-miR-92a-1-5p	Microarray, qRT-PCR	26283734
MIRT734220	hsa-miR-122-5p	Luciferase reporter assay, qRT-PCR, Western blot	26239639

Transcription factors

Transcription factor	Regulation	Reference
FOS	Unknown	8688489
JUN	Unknown	8688489
NFKB1	Repression	17612514
RELA	Repression	17612514

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001660	Process	Fever generation	IEA
GO:0001819	Process	Positive regulation of cytokine production	IDA	1739124
GO:0002248	Process	Connective tissue replacement involved in inflammatory response wound healing	IEA
GO:0005125	Function	Cytokine activity	IMP	2989698
GO:0005149	Function	Interleukin-1 receptor binding	IEA
GO:0005507	Function	Copper ion binding	IDA	12746488
GO:0005515	Function	Protein binding	IPI	12746488, 16971486, 18329368, 25241761, 25416956, 25910212
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	12746488
GO:0005615	Component	Extracellular space	IMP	3493774
GO:0005829	Component	Cytosol	IDA	12746488
GO:0006883	Process	Cellular sodium ion homeostasis	IEA
GO:0006915	Process	Apoptotic process	TAS	1924307
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006955	Process	Immune response	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	3493774
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	ISS
GO:0010628	Process	Positive regulation of gene expression	IBA	21873635
GO:0010628	Process	Positive regulation of gene expression	IDA	23817958
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	IMP	2989698
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0032743	Process	Positive regulation of interleukin-2 production	IMP	2989698
GO:0032743	Process	Positive regulation of interleukin-2 production	ISS	31172560
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS	31172560
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS	31172560
GO:0033092	Process	Positive regulation of immature T cell proliferation in thymus	IBA	21873635
GO:0034605	Process	Cellular response to heat	IDA	12746488
GO:0035234	Process	Ectopic germ cell programmed cell death	IEA
GO:0045766	Process	Positive regulation of angiogenesis	ISS
GO:0045840	Process	Positive regulation of mitotic nuclear division	IMP	2989698
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046688	Process	Response to copper ion	IDA	12746488
GO:0050714	Process	Positive regulation of protein secretion	IMP	9564845
GO:0050999	Process	Regulation of nitric-oxide synthase activity	IBA	21873635
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA	21873635
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	TAS	10748004

Other IDs

• MIM: 147760
• HGNC: 5991
• e!Ensembl: ENSG00000115008

Protein

• UniProt ID: P01583
• Protein name: Interleukin-1 alpha (IL-1 alpha) (Hematopoietin-1)
• Protein function: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
• PDB: 1ITA, 2ILA, 2KKI, 2L5X, 5UC6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02394	IL1_propep	1 → 109	Interleukin-1 propeptide	Family
  PF00340	IL1	155 → 266	Interleukin-1 / 18	Domain

• Sequence:

  MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETS
  KTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLS
  NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKI
  TVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHP
  NLFIATKQDYWVCLAGGPPSITDFQILENQA

• Sequence length: 271