IL17RC (interleukin 17 receptor C)

Gene

• Entrez ID: 84818
• Gene name: Interleukin 17 receptor C
• Gene symbol: IL17RC
• Synonyms: CANDF9, IL17-RL, IL17RL
• Chromosome: 3
• Chromosome location: 3p25.3|3p25.3-p24.1
• Summary: This gene encodes a single-pass type I membrane protein that shares similarity with the interleukin-17 receptor (IL-17RA). Unlike IL-17RA, which is predominantly expressed in hemopoietic cells, and binds with high affinity to only IL-17A, this protein is expressed in nonhemopoietic tissues, and binds both IL-17A and IL-17F with similar affinities. The proinflammatory cytokines, IL-17A and IL-17F, have been implicated in the progression of inflammatory and autoimmune diseases. Multiple alternatively spliced transcript variants encoding different isoforms have been detected for this gene, and it has been proposed that soluble, secreted proteins lacking transmembrane and intracellular domains may function as extracellular antagonists to cytokine signaling. [provided by RefSeq, Feb 2011]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs559955121	C>T	Likely-pathogenic	Coding sequence variant, stop gained, non coding transcript variant
rs773852926	C>T	Pathogenic	Non coding transcript variant, coding sequence variant, stop gained
rs1057518751	C>T	Pathogenic	Stop gained, non coding transcript variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028962	hsa-miR-26b-5p	Microarray	19088304
MIRT036625	hsa-miR-940	CLASH	23622248
MIRT050548	hsa-miR-20a-5p	CLASH	23622248
MIRT052327	hsa-let-7b-5p	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	24120361, 28827714
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0009986	Component	Cell surface	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0030368	Function	Interleukin-17 receptor activity	IBA	21873635
GO:0030368	Function	Interleukin-17 receptor activity	IDA	17911633
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0050832	Process	Defense response to fungus	IEA
GO:0071621	Process	Granulocyte chemotaxis	IEA
GO:0097400	Process	Interleukin-17-mediated signaling pathway	TAS
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IEA

Other IDs

• MIM: 610925
• HGNC: 18358
• e!Ensembl: ENSG00000163702

Protein

• UniProt ID: Q8NAC3
• Protein name: Interleukin-17 receptor C (IL-17 receptor C) (IL-17RC) (Interleukin-17 receptor homolog) (IL17Rhom) (Interleukin-17 receptor-like protein) (IL-17RL) (ZcytoR14)
• Protein function: Receptor for IL17A and IL17F, major effector cytokines of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity (By similarity). Receptor for IL17A and IL17F, major effector cytokines of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity. Receptor for IL17A and IL17F homodimers as part of a heterodimeric complex with IL17RA (PubMed:16785495). Receptor for the heterodimer formed by IL17A and IL17B as part of a heterodimeric complex with IL17RA (PubMed:18684971). Has also been shown to be the cognate receptor for IL17F and to bind IL17A with high affinity without the need for IL17RA (PubMed:17911633). Upon binding of IL17F homodimer triggers downstream activation of TRAF6 and NF-kappa-B signaling pathway (PubMed:16785495, PubMed:32187518). Induces transcriptional activation of IL33, a potent cytokine that stimulates group 2 innate lymphoid cells and adaptive T-helper 2 cells involved in pulmonary allergic response to fungi (By similarity). Promotes sympathetic innervation of peripheral organs by coordinating the communication between gamma-delta T cells and parenchymal cells. Stimulates sympathetic innervation of thermogenic adipose tissue by driving TGFB1 expression (By similarity). Binding of IL17A-IL17F to IL17RA-IL17RC heterodimeric receptor complex triggers homotypic interaction of IL17RA and IL17RC chains with TRAF3IP2 adapter through SEFIR domains. This leads to downstream TRAF6-mediated activation of NF-kappa-B and MAPkinase pathways ultimately resulting in transcriptional activation of cytokines, chemokines, antimicrobial peptides and matrix metalloproteinases, with potential strong immune inflammation (PubMed:18684971, PubMed:17911633). Primarily induces neutrophil activation and recruitment at infection and inflammatory sites (By similarity). Stimulates the production of antimicrobial beta-defensins DEFB1, DEFB103A, and DEFB104A by mucosal epithelial cells, limiting the entry of microbes through the epithelial barriers (By similarity). ; [Isoform 5]: Receptor for both IL17A and IL17F. ; [Isoform 6]: Does not bind IL17A or IL17F. ; [Isoform 7]: Does not bind IL17A or IL17F. ; [Isoform 8]: Receptor for both IL17A and IL17F.
• PDB: 6HG4, 6HG9, 6HGA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15037	IL17_R_N	142 → 530	Interleukin-17 receptor extracellular region	Family
  PF08357	SEFIR	584 → 737	SEFIR domain	Family

• Sequence:

  MPVPWFLLSLALGRSPVVLSLERLVGPQDATHCSPVSLEPWGDEERLRVQFLAQQSLSLA
  PVTAATARTALSGLSGADGRREERGRGKSWVCLSLGGSGNTEPQKKGLSCRLWDSDILCL
  PGDIVPAPGPVLAPTHLQTELVLRCQKETDCDLCLRVAVHLAVHGHWEEPEDEEKFGGAA
  DSGVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPAALVQFGQSVGSVVYDCFEAALGS
  EVRIWSYTQPRYEKELNHTQQLPDCRGLEVWNSIPSCWALPWLNVSADGDNVHLVLNVSE
  EQHFGLSLYWNQVQGPPKPRWHKNLTGPQIITLNHTDLVPCLCIQVWPLEPDSVRTNICP
  FREDPRAHQNLWQAARLQLLTLQSWLLDAPCSLPAEAALCWRAPGGDPCQPLVPPLSWEN
  VTVDKVLEFPLLKGHPNLCVQVNSSEKLQLQECLWADSLGPLKDDVLLLETRGPQDNRSL
  CALEPSGCTSLPSKASTRAARLGEYLLQDLQSGQCLQLWDDDLGALWACPMDKYIHKRWA
  LVWLACLLFAAALSLILLLKKDHAKGWLRLLKQDVRSGAAARGRAALLLYSADDSGFERL
  VGALASALCQLPLRVAVDLWSRRELSAQGPVAWFHAQRRQTLQEGGVVVLLFSPGAVALC
  SEWLQDGVSGPGAHGPHDAFRASLSCVLPDFLQGRAPGSYVGACFDRLLHPDAVPALFRT
  VPVFTLPSQLPDFLGALQQPRAPRSGRLQERAEQVSRALQPALDSYFHPPGTPAPGRGVG
  PGAGPGAGDGT

• Sequence length: 791