IL17A (interleukin 17A)

Gene

• Entrez ID: 3605
• Gene name: Interleukin 17A
• Gene symbol: IL17A
• Synonyms: CTLA-8, CTLA8, IL-17, IL-17A, IL17, ILA17
• Chromosome: 6
• Chromosome location: 6p12.2
• Summary: This gene is a member of the IL-17 receptor family which includes five members (IL-17RA-E) and the encoded protein is a proinflammatory cytokine produced by activated T cells. IL-17A-mediated downstream pathways induce the production of inflammatory molec

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016706	hsa-miR-335-5p	Microarray	18185580
MIRT734534	hsa-miR-122-3p	ELISA, Luciferase reporter assay	33230454
MIRT734536	hsa-miR-30a-3p	ELISA, Luciferase reporter assay	33230454
MIRT735527	hsa-miR-126-5p	Flow cytometry, Luciferase reporter assay, qRT-PCR, Western blotting	33365067
MIRT1063794	hsa-miR-1236	CLIP-seq
MIRT1063795	hsa-miR-1299	CLIP-seq
MIRT1063796	hsa-miR-153	CLIP-seq
MIRT1063797	hsa-miR-3664-5p	CLIP-seq
MIRT1063798	hsa-miR-448	CLIP-seq
MIRT1063799	hsa-miR-4714-5p	CLIP-seq
MIRT1063800	hsa-miR-606	CLIP-seq
MIRT1063801	hsa-miR-618	CLIP-seq
MIRT1063802	hsa-miR-875-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HDAC11	Repression	21239696
NFKB1	Unknown	21243522
RELA	Unknown	21243522
RORC	Unknown	19578368

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002225	Process	Positive regulation of antimicrobial peptide production	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	23695682, 25416956, 28827714, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0006915	Process	Apoptotic process	TAS	7499828
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	TAS	7499828
GO:0007267	Process	Cell-cell signaling	TAS	7499828
GO:0008219	Process	Cell death	TAS	8390535
GO:0009897	Component	External side of plasma membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	29734196
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	29734196
GO:0032739	Process	Positive regulation of interleukin-16 production	IDA	29734196
GO:0032747	Process	Positive regulation of interleukin-23 production	IDA	21145111
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	21350122
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	29734196
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	IDA	17888176
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16982811
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050832	Process	Defense response to fungus	IEA
GO:0060729	Process	Intestinal epithelial structure maintenance	IEA
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0072537	Process	Fibroblast activation	IDA	21145111
GO:0097400	Process	Interleukin-17-mediated signaling pathway	IDA	21350122
GO:0097400	Process	Interleukin-17-mediated signaling pathway	TAS
GO:0097530	Process	Granulocyte migration	IEA
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IDA	29734196
GO:1903348	Process	Positive regulation of bicellular tight junction assembly	IEA
GO:2000340	Process	Positive regulation of chemokine (C-X-C motif) ligand 1 production	IDA	21350122

Other IDs

• MIM: 603149
• HGNC: 5981
• e!Ensembl: ENSG00000112115

Protein

• UniProt ID: Q16552
• Protein name: Interleukin-17A (IL-17) (IL-17A) (Cytotoxic T-lymphocyte-associated antigen 8) (CTLA-8)
• Protein function: Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity (PubMed:24120361). Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL
• PDB: 2VXS, 4HR9, 4HSA, 4QHU, 5HHV, 5HHX, 5HI3, 5HI4, 5HI5, 5N7W, 5N92, 5NAN, 5VB9, 6WIO, 6WIR, 7AMA, 7AMG, 7UWM, 7UWN, 7WKX, 7Z2M, 7ZAN, 8B7W, 8CDG, 8DY1, 8DY5, 8DYF, 8DYG, 8DYH, 8DYI, 8USR, 8USS, 9FKX, 9FL3, 9H4D, 9H4O
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06083	IL17	69 → 147	Interleukin-17	Family

• Sequence:

  MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNP
  KRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEIL
  VLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

• Sequence length: 155