GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

IL12B (interleukin 12B)

Gene

3593

Interleukin 12B

IL12B

CLMF, CLMF2, IL-12B, IMD28, IMD29, NKSF, NKSF2

5q33.3

This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encode

Show/Hide all(50)

miRTarBase ID	miRNA	Experiments	Reference
MIRT715156	hsa-miR-3614-3p	HITS-CLIP	19536157
MIRT715155	hsa-miR-4705	HITS-CLIP	19536157
MIRT715154	hsa-miR-103b	HITS-CLIP	19536157
MIRT715153	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT715152	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT715151	hsa-miR-4284	HITS-CLIP	19536157
MIRT734760	hsa-miR-34a-3p	Microarray, qRT-PCR	33713393
MIRT715156	hsa-miR-3614-3p	HITS-CLIP	19536157
MIRT715155	hsa-miR-4705	HITS-CLIP	19536157
MIRT715154	hsa-miR-103b	HITS-CLIP	19536157
MIRT715153	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT715152	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT715151	hsa-miR-4284	HITS-CLIP	19536157
MIRT1063608	hsa-miR-1207-3p	CLIP-seq
MIRT1063609	hsa-miR-3649	CLIP-seq
MIRT1063610	hsa-miR-3675-3p	CLIP-seq
MIRT1063611	hsa-miR-4716-5p	CLIP-seq
MIRT1063612	hsa-miR-587	CLIP-seq
MIRT2015022	hsa-miR-129-5p	CLIP-seq
MIRT2015023	hsa-miR-1915	CLIP-seq
MIRT2015024	hsa-miR-193a-5p	CLIP-seq
MIRT2015025	hsa-miR-3674	CLIP-seq
MIRT2015026	hsa-miR-4307	CLIP-seq
MIRT2015027	hsa-miR-4436b-5p	CLIP-seq
MIRT2015028	hsa-miR-4720-3p	CLIP-seq
MIRT2015029	hsa-miR-4726-3p	CLIP-seq
MIRT2015030	hsa-miR-4732-5p	CLIP-seq
MIRT2015031	hsa-miR-4804-3p	CLIP-seq
MIRT2015032	hsa-miR-483-5p	CLIP-seq
MIRT2015033	hsa-miR-889	CLIP-seq
MIRT2247354	hsa-miR-1200	CLIP-seq
MIRT2247355	hsa-miR-1343	CLIP-seq
MIRT2247356	hsa-miR-141	CLIP-seq
MIRT2247357	hsa-miR-192	CLIP-seq
MIRT2247358	hsa-miR-200a	CLIP-seq
MIRT2247359	hsa-miR-215	CLIP-seq
MIRT2247360	hsa-miR-219-5p	CLIP-seq
MIRT2247361	hsa-miR-335	CLIP-seq
MIRT2247362	hsa-miR-378g	CLIP-seq
MIRT2247363	hsa-miR-4437	CLIP-seq
MIRT2247364	hsa-miR-4445	CLIP-seq
MIRT2247365	hsa-miR-4674	CLIP-seq
MIRT2247366	hsa-miR-4774-5p	CLIP-seq
MIRT2247367	hsa-miR-4782-3p	CLIP-seq
MIRT2247368	hsa-miR-508-3p	CLIP-seq
MIRT2247369	hsa-miR-548a-3p	CLIP-seq
MIRT2247370	hsa-miR-548e	CLIP-seq
MIRT2247371	hsa-miR-548f	CLIP-seq
MIRT2451701	hsa-miR-1182	CLIP-seq
MIRT2451702	hsa-miR-4778-5p	CLIP-seq

Transcription factors

Show/Hide all(12)

Transcription factor	Regulation	Reference
EP300	Activation	15482860
ETS2	Unknown	10657616
IRF1	Unknown	10657616
JUN	Activation	14688340
KLF1	Unknown	14976188
NFKB1	Activation	14688340;18690006
NFKB1	Unknown	10657616
REL	Unknown	10657616
RELA	Activation	14688340;18690006
RELA	Unknown	10657616;15270850
SPI1	Unknown	11254706
VDR	Repression	21310195

Show/Hide all(88)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001817	Process	Regulation of cytokine production	TAS	1673147
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	ISS
GO:0002230	Process	Positive regulation of defense response to virus by host	IDA	12421946
GO:0002230	Process	Positive regulation of defense response to virus by host	ISS
GO:0002323	Process	Natural killer cell activation involved in immune response	IEA
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IDA	15114670
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	ISS
GO:0002860	Process	Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IDA	7903063
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	IEA
GO:0004896	Function	Cytokine receptor activity	IBA	21873635
GO:0005125	Function	Cytokine activity	IDA	1674604
GO:0005143	Function	Interleukin-12 receptor binding	TAS	1674604
GO:0005143	Function	Interleukin-12 receptor binding	TAS	9603733
GO:0005515	Function	Protein binding	IPI	7527811, 10899108, 11023671, 11114383, 12023369, 18680750, 29997244
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	TAS	1673147
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005829	Component	Cytosol	TAS
GO:0007050	Process	Cell cycle arrest	IDA	16942485
GO:0008083	Function	Growth factor activity	IDA	1674604
GO:0008283	Process	Cell population proliferation	IEA
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0010224	Process	Response to UV-B	IDA	8992506
GO:0010536	Process	Positive regulation of activation of Janus kinase activity	IDA	12023369
GO:0016477	Process	Cell migration	IDA	7903063
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019233	Process	Sensory perception of pain	IEA
GO:0019953	Process	Sexual reproduction	TAS	16772281
GO:0019955	Function	Cytokine binding	IBA	21873635
GO:0030101	Process	Natural killer cell activation	IDA	1673147
GO:0031906	Component	Late endosome lumen	TAS
GO:0032609	Process	Interferon-gamma production	TAS	1673147
GO:0032693	Process	Negative regulation of interleukin-10 production	IMP	16751425
GO:0032700	Process	Negative regulation of interleukin-17 production	IDA	16482511
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	20027291
GO:0032729	Process	Positive regulation of interferon-gamma production	IDA	1674604, 11114383, 19088061, 20027291
GO:0032729	Process	Positive regulation of interferon-gamma production	TAS	1673147
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	15265908
GO:0032733	Process	Positive regulation of interleukin-10 production	TAS	18675459
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	20027291
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	16482511, 16751425, 17888176
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	16751425
GO:0032816	Process	Positive regulation of natural killer cell activation	IC	20027291
GO:0032816	Process	Positive regulation of natural killer cell activation	IDA	1674604
GO:0032819	Process	Positive regulation of natural killer cell proliferation	IDA	19088061
GO:0032946	Process	Positive regulation of mononuclear cell proliferation	IMP	11023671
GO:0034105	Process	Positive regulation of tissue remodeling	IC	16482511
GO:0034393	Process	Positive regulation of smooth muscle cell apoptotic process	IDA	16942485
GO:0035722	Process	Interleukin-12-mediated signaling pathway	TAS
GO:0038155	Process	Interleukin-23-mediated signaling pathway	TAS
GO:0042088	Process	T-helper 1 type immune response	TAS	1673147
GO:0042093	Process	T-helper cell differentiation	IDA	1673147
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	12023369
GO:0042104	Process	Positive regulation of activated T cell proliferation	IDA	1674604, 11114383
GO:0042164	Function	Interleukin-12 alpha subunit binding	IBA	21873635
GO:0042164	Function	Interleukin-12 alpha subunit binding	IPI	11023671
GO:0042509	Process	Regulation of tyrosine phosphorylation of STAT protein	IDA	12023369
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	12023369
GO:0042802	Function	Identical protein binding	IPI	7527811
GO:0042832	Process	Defense response to protozoan	IEA
GO:0043235	Component	Receptor complex	IBA	21873635
GO:0043382	Process	Positive regulation of memory T cell differentiation	ISS
GO:0043514	Component	Interleukin-12 complex	IBA	21873635
GO:0043514	Component	Interleukin-12 complex	IDA	1674604, 11114383
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045519	Function	Interleukin-23 receptor binding	IDA	11114383
GO:0045672	Process	Positive regulation of osteoclast differentiation	IDA	17888176
GO:0045785	Process	Positive regulation of cell adhesion	IDA	7903063
GO:0046982	Function	Protein heterodimerization activity	IPI	1674604, 11023671
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	16942485
GO:0050671	Process	Positive regulation of lymphocyte proliferation	IDA	1674604
GO:0050709	Process	Negative regulation of protein secretion	IGI	30106099
GO:0050729	Process	Positive regulation of inflammatory response	IC	16482511
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	15114670, 20027291
GO:0051135	Process	Positive regulation of NK T cell activation	IC	20027291
GO:0051135	Process	Positive regulation of NK T cell activation	IDA	19088061
GO:0051142	Process	Positive regulation of NK T cell proliferation	IDA	19088061
GO:0051607	Process	Defense response to virus	IEA
GO:0070743	Component	Interleukin-23 complex	IBA	21873635
GO:0070743	Component	Interleukin-23 complex	IDA	11114383
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071346	Process	Cellular response to interferon-gamma	IEA
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IGI	30106099
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	TAS	20428758
GO:1903588	Process	Negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IGI	30106099
GO:2000318	Process	Positive regulation of T-helper 17 type immune response	ISS
GO:2000330	Process	Positive regulation of T-helper 17 cell lineage commitment	ISS

MIM	HGNC	e!Ensembl
161561	5970	ENSG00000113302

Protein

UniProt ID

P29460

Protein name

Interleukin-12 subunit beta (IL-12B) (Cytotoxic lymphocyte maturation factor 40 kDa subunit) (CLMF p40) (IL-12 subunit p40) (NK cell stimulatory factor chain 2) (NKSF2)

Protein function

Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC. ; Assoc

PDB

1F42 , 1F45 , 3D85 , 3D87 , 3DUH , 3HMX , 3QWR , 4GRW , 5MJ3 , 5MJ4 , 5MXA , 5MZV , 5NJD , 6UIB , 6WDQ , 8CR8 , 8OE4 , 8XRP , 8YI7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10420	IL12p40_C	126 → 216	Cytokine interleukin-12p40 C-terminus	Domain

Sequence

MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
TLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQ
KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERV
RGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC
RKNASISVRAQDRYYSSSWSEWASVPCS

Sequence length

328

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412