IL12A (interleukin 12A)

Gene

• Entrez ID: 3592
• Gene name: Interleukin 12A
• Gene symbol: IL12A
• Synonyms: CLMF, IL-12A, NFSK, NKSF1, P35
• Chromosome: 3
• Chromosome location: 3q25.33
• Summary: This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030009	hsa-miR-26b-5p	Microarray	19088304
MIRT208864	hsa-miR-21-5p	Microarray, qRT-PCR	22815788
MIRT208864	hsa-miR-21-5p	Luciferase reporter assay, Western blot	25327529
MIRT208864	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	27571873
MIRT733200	hsa-miR-10a-5p	ELISA, qRT-PCR	25281418

Transcription factors

Transcription factor	Regulation	Reference
IRF1	Unknown	16622221
IRF8	Unknown	16622221
JUN	Unknown	22904313
NFKB1	Activation	18690006
RELA	Activation	18690006

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IDA	1674604, 2204066
GO:0002860	Process	Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IDA	7903063
GO:0005125	Function	Cytokine activity	IDA	1674604
GO:0005125	Function	Cytokine activity	TAS	1673147
GO:0005143	Function	Interleukin-12 receptor binding	NAS	1674604
GO:0005515	Function	Protein binding	IPI	7527811, 10899108, 11023671
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	16456693
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0006955	Process	Immune response	TAS	9789052
GO:0007050	Process	Cell cycle arrest	IDA	16942485
GO:0008083	Function	Growth factor activity	IDA	1674604
GO:0008083	Function	Growth factor activity	NAS	1673147
GO:0009615	Process	Response to virus	IEP	16548883
GO:0010224	Process	Response to UV-B	IDA	8992506
GO:0016032	Process	Viral process	IEA
GO:0016477	Process	Cell migration	IDA	7903063
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0031906	Component	Late endosome lumen	TAS
GO:0032496	Process	Response to lipopolysaccharide	IDA	7605994, 8557999
GO:0032700	Process	Negative regulation of interleukin-17 production	IDA	16482511
GO:0032729	Process	Positive regulation of interferon-gamma production	IDA	1674604, 11114383, 19088061
GO:0032816	Process	Positive regulation of natural killer cell activation	IDA	1674604
GO:0032946	Process	Positive regulation of mononuclear cell proliferation	IMP	11023671
GO:0034393	Process	Positive regulation of smooth muscle cell apoptotic process	IDA	16942485
GO:0035722	Process	Interleukin-12-mediated signaling pathway	TAS
GO:0042163	Function	Interleukin-12 beta subunit binding	IPI	11023671
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	12372421
GO:0043514	Component	Interleukin-12 complex	IDA	2204066, 11023671, 11114383
GO:0043514	Component	Interleukin-12 complex	NAS	1674604, 14718574
GO:0045513	Function	Interleukin-27 binding	IPI	9342359
GO:0045785	Process	Positive regulation of cell adhesion	IDA	7903063
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IDA	2204066
GO:0046982	Function	Protein heterodimerization activity	IPI	1674604, 11023671
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	16942485
GO:0050671	Process	Positive regulation of lymphocyte proliferation	IDA	1674604, 2204066
GO:0050709	Process	Negative regulation of protein secretion	IGI	30106099
GO:0050830	Process	Defense response to Gram-positive bacterium	IEP	1357073
GO:0051135	Process	Positive regulation of NK T cell activation	IDA	19088061
GO:0070757	Process	Interleukin-35-mediated signaling pathway	TAS
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	16942485
GO:0098586	Process	Cellular response to virus	IMP	25754930
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IGI	30106099
GO:1903588	Process	Negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IGI	30106099
GO:2000510	Process	Positive regulation of dendritic cell chemotaxis	IMP	25754930

Other IDs

• MIM: 161560
• HGNC: 5969
• e!Ensembl: ENSG00000168811

Protein

• UniProt ID: P29459
• Protein name: Interleukin-12 subunit alpha (IL-12A) (Cytotoxic lymphocyte maturation factor 35 kDa subunit) (CLMF p35) (IL-12 subunit p35) (NK cell stimulatory factor chain 1) (NKSF1)
• Protein function: Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.
• PDB: 1F45, 3HMX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03039	IL12	6 → 219	Interleukin-12 alpha subunit	Domain

• Sequence:

  MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLE
  FYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMM
  ALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQK
  SSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

• Sequence length: 219