GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

IL10 (interleukin 10)

Gene

3586

Interleukin 10

IL10

CSIF, GVHDS, IL-10, IL10A, TGIF

1q32.1

The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class

Show/Hide all(231)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005082	hsa-miR-106a-5p	Luciferase reporter assay, qRT-PCR	19307576
MIRT054365	hsa-let-7c-5p	Luciferase reporter assay, qRT-PCR	22835429
MIRT054365	hsa-let-7c-5p	Luciferase reporter assay, qRT-PCR	22835429
MIRT731372	hsa-miR-194-5p	Luciferase reporter assay, Microarray, qRT-PCR	26147452
MIRT731372	hsa-miR-194-5p	Luciferase reporter assay, Microarray, qRT-PCR	26147452
MIRT734608	hsa-miR-1-3p	qRT-PCR, Flow cytometry	33584638
MIRT734609	hsa-miR-20a-3p	qRT-PCR, Flow cytometry	33584638
MIRT734610	hsa-miR-28-3p	qRT-PCR, Flow cytometry	33584638
MIRT734611	hsa-miR-95-3p	qRT-PCR, Flow cytometry	33584638
MIRT734612	hsa-miR-146a-3p	qRT-PCR, Flow cytometry	33584638
MIRT734613	hsa-miR-335-3p	qRT-PCR, Flow cytometry	33584638
MIRT734614	hsa-miR-625-3p	qRT-PCR, Flow cytometry	33584638
MIRT736457	hsa-miR-3928-5p	Western blotting, qRT-PCR	33125125
MIRT736491	hsa-miR-21-3p	Immunofluorescence, qRT-PCR, ELISA	33110923
MIRT756216	hsa-miR-374b-5p	Luciferase reporter assay, Western blotting, qRT-PCR	36437465
MIRT1063421	hsa-miR-106a	CLIP-seq
MIRT1063422	hsa-miR-106b	CLIP-seq
MIRT1063423	hsa-miR-1236	CLIP-seq
MIRT1063424	hsa-miR-1245	CLIP-seq
MIRT1063425	hsa-miR-1321	CLIP-seq
MIRT1063426	hsa-miR-150	CLIP-seq
MIRT1063427	hsa-miR-1587	CLIP-seq
MIRT1063428	hsa-miR-17	CLIP-seq
MIRT1063429	hsa-miR-20a	CLIP-seq
MIRT1063430	hsa-miR-20b	CLIP-seq
MIRT1063431	hsa-miR-302a	CLIP-seq
MIRT1063432	hsa-miR-302b	CLIP-seq
MIRT1063433	hsa-miR-302c	CLIP-seq
MIRT1063434	hsa-miR-302d	CLIP-seq
MIRT1063435	hsa-miR-302e	CLIP-seq
MIRT1063436	hsa-miR-3074-3p	CLIP-seq
MIRT1063437	hsa-miR-3135b	CLIP-seq
MIRT1063438	hsa-miR-3652	CLIP-seq
MIRT1063439	hsa-miR-369-3p	CLIP-seq
MIRT1063440	hsa-miR-372	CLIP-seq
MIRT1063441	hsa-miR-373	CLIP-seq
MIRT1063442	hsa-miR-374a	CLIP-seq
MIRT1063443	hsa-miR-374b	CLIP-seq
MIRT1063444	hsa-miR-3914	CLIP-seq
MIRT1063445	hsa-miR-4253	CLIP-seq
MIRT1063446	hsa-miR-4270	CLIP-seq
MIRT1063447	hsa-miR-4419a	CLIP-seq
MIRT1063448	hsa-miR-4430	CLIP-seq
MIRT1063449	hsa-miR-4441	CLIP-seq
MIRT1063450	hsa-miR-4510	CLIP-seq
MIRT1063451	hsa-miR-4668-5p	CLIP-seq
MIRT1063452	hsa-miR-4674	CLIP-seq
MIRT1063453	hsa-miR-4688	CLIP-seq
MIRT1063454	hsa-miR-4731-5p	CLIP-seq
MIRT1063455	hsa-miR-4739	CLIP-seq
MIRT1063456	hsa-miR-4753-3p	CLIP-seq
MIRT1063457	hsa-miR-4756-5p	CLIP-seq
MIRT1063458	hsa-miR-4768-5p	CLIP-seq
MIRT1063459	hsa-miR-496	CLIP-seq
MIRT1063460	hsa-miR-512-3p	CLIP-seq
MIRT1063461	hsa-miR-519d	CLIP-seq
MIRT1063462	hsa-miR-520a-3p	CLIP-seq
MIRT1063463	hsa-miR-520b	CLIP-seq
MIRT1063464	hsa-miR-520c-3p	CLIP-seq
MIRT1063465	hsa-miR-520d-3p	CLIP-seq
MIRT1063466	hsa-miR-520e	CLIP-seq
MIRT1063467	hsa-miR-520g	CLIP-seq
MIRT1063468	hsa-miR-520h	CLIP-seq
MIRT1063469	hsa-miR-570	CLIP-seq
MIRT1063470	hsa-miR-640	CLIP-seq
MIRT1063471	hsa-miR-877	CLIP-seq
MIRT1063472	hsa-miR-93	CLIP-seq
MIRT1550094	hsa-miR-1	CLIP-seq
MIRT1550095	hsa-miR-206	CLIP-seq
MIRT1550096	hsa-miR-3155	CLIP-seq
MIRT1550097	hsa-miR-3155b	CLIP-seq
MIRT1550098	hsa-miR-3673	CLIP-seq
MIRT1550099	hsa-miR-484	CLIP-seq
MIRT1550100	hsa-miR-613	CLIP-seq
MIRT1063424	hsa-miR-1245	CLIP-seq
MIRT2014982	hsa-miR-197	CLIP-seq
MIRT1063437	hsa-miR-3135b	CLIP-seq
MIRT2014983	hsa-miR-3149	CLIP-seq
MIRT2014984	hsa-miR-3194-3p	CLIP-seq
MIRT1063438	hsa-miR-3652	CLIP-seq
MIRT2014985	hsa-miR-411	CLIP-seq
MIRT2014986	hsa-miR-431	CLIP-seq
MIRT1063448	hsa-miR-4430	CLIP-seq
MIRT1063453	hsa-miR-4688	CLIP-seq
MIRT2014987	hsa-miR-4716-5p	CLIP-seq
MIRT2014988	hsa-miR-4735-5p	CLIP-seq
MIRT2014989	hsa-miR-4775	CLIP-seq
MIRT2014990	hsa-miR-4797-5p	CLIP-seq
MIRT2014991	hsa-miR-483-5p	CLIP-seq
MIRT2014992	hsa-miR-5096	CLIP-seq
MIRT2014993	hsa-miR-590-3p	CLIP-seq
MIRT1063470	hsa-miR-640	CLIP-seq
MIRT2014994	hsa-miR-924	CLIP-seq
MIRT1063421	hsa-miR-106a	CLIP-seq
MIRT1063422	hsa-miR-106b	CLIP-seq
MIRT1063424	hsa-miR-1245	CLIP-seq
MIRT2247336	hsa-miR-129-5p	CLIP-seq
MIRT1063426	hsa-miR-150	CLIP-seq
MIRT1063428	hsa-miR-17	CLIP-seq
MIRT1063429	hsa-miR-20a	CLIP-seq
MIRT1063430	hsa-miR-20b	CLIP-seq
MIRT1063431	hsa-miR-302a	CLIP-seq
MIRT1063432	hsa-miR-302b	CLIP-seq
MIRT1063433	hsa-miR-302c	CLIP-seq
MIRT1063434	hsa-miR-302d	CLIP-seq
MIRT1063435	hsa-miR-302e	CLIP-seq
MIRT1063436	hsa-miR-3074-3p	CLIP-seq
MIRT1063437	hsa-miR-3135b	CLIP-seq
MIRT2014983	hsa-miR-3149	CLIP-seq
MIRT2014984	hsa-miR-3194-3p	CLIP-seq
MIRT1063438	hsa-miR-3652	CLIP-seq
MIRT2247337	hsa-miR-3672	CLIP-seq
MIRT1063440	hsa-miR-372	CLIP-seq
MIRT1063441	hsa-miR-373	CLIP-seq
MIRT1063445	hsa-miR-4253	CLIP-seq
MIRT2014986	hsa-miR-431	CLIP-seq
MIRT1063448	hsa-miR-4430	CLIP-seq
MIRT1063453	hsa-miR-4688	CLIP-seq
MIRT1063454	hsa-miR-4731-5p	CLIP-seq
MIRT2014988	hsa-miR-4735-5p	CLIP-seq
MIRT1063456	hsa-miR-4753-3p	CLIP-seq
MIRT2014989	hsa-miR-4775	CLIP-seq
MIRT2247338	hsa-miR-4783-5p	CLIP-seq
MIRT2247339	hsa-miR-5095	CLIP-seq
MIRT1063460	hsa-miR-512-3p	CLIP-seq
MIRT1063461	hsa-miR-519d	CLIP-seq
MIRT1063462	hsa-miR-520a-3p	CLIP-seq
MIRT1063463	hsa-miR-520b	CLIP-seq
MIRT1063464	hsa-miR-520c-3p	CLIP-seq
MIRT1063465	hsa-miR-520d-3p	CLIP-seq
MIRT1063466	hsa-miR-520e	CLIP-seq
MIRT1063467	hsa-miR-520g	CLIP-seq
MIRT1063468	hsa-miR-520h	CLIP-seq
MIRT2247340	hsa-miR-552	CLIP-seq
MIRT2247341	hsa-miR-562	CLIP-seq
MIRT2014993	hsa-miR-590-3p	CLIP-seq
MIRT1063470	hsa-miR-640	CLIP-seq
MIRT2247342	hsa-miR-764	CLIP-seq
MIRT2014994	hsa-miR-924	CLIP-seq
MIRT1063472	hsa-miR-93	CLIP-seq
MIRT1063436	hsa-miR-3074-3p	CLIP-seq
MIRT1063437	hsa-miR-3135b	CLIP-seq
MIRT1063438	hsa-miR-3652	CLIP-seq
MIRT1063445	hsa-miR-4253	CLIP-seq
MIRT1063448	hsa-miR-4430	CLIP-seq
MIRT1063453	hsa-miR-4688	CLIP-seq
MIRT1063427	hsa-miR-1587	CLIP-seq
MIRT1063439	hsa-miR-369-3p	CLIP-seq
MIRT1063442	hsa-miR-374a	CLIP-seq
MIRT1063443	hsa-miR-374b	CLIP-seq
MIRT2437783	hsa-miR-4263	CLIP-seq
MIRT1063452	hsa-miR-4674	CLIP-seq
MIRT2437784	hsa-miR-4799-5p	CLIP-seq
MIRT2437785	hsa-miR-576-5p	CLIP-seq
MIRT1063427	hsa-miR-1587	CLIP-seq
MIRT1063439	hsa-miR-369-3p	CLIP-seq
MIRT1063442	hsa-miR-374a	CLIP-seq
MIRT1063443	hsa-miR-374b	CLIP-seq
MIRT2437783	hsa-miR-4263	CLIP-seq
MIRT1063452	hsa-miR-4674	CLIP-seq
MIRT2437784	hsa-miR-4799-5p	CLIP-seq
MIRT2437785	hsa-miR-576-5p	CLIP-seq
MIRT1063425	hsa-miR-1321	CLIP-seq
MIRT2014983	hsa-miR-3149	CLIP-seq
MIRT2014985	hsa-miR-411	CLIP-seq
MIRT1063447	hsa-miR-4419a	CLIP-seq
MIRT1063450	hsa-miR-4510	CLIP-seq
MIRT2014988	hsa-miR-4735-5p	CLIP-seq
MIRT1063455	hsa-miR-4739	CLIP-seq
MIRT1063457	hsa-miR-4756-5p	CLIP-seq
MIRT2014989	hsa-miR-4775	CLIP-seq
MIRT2247338	hsa-miR-4783-5p	CLIP-seq
MIRT2014991	hsa-miR-483-5p	CLIP-seq
MIRT2451691	hsa-miR-577	CLIP-seq
MIRT2014993	hsa-miR-590-3p	CLIP-seq
MIRT2247342	hsa-miR-764	CLIP-seq
MIRT1063471	hsa-miR-877	CLIP-seq
MIRT1063425	hsa-miR-1321	CLIP-seq
MIRT2014983	hsa-miR-3149	CLIP-seq
MIRT2014985	hsa-miR-411	CLIP-seq
MIRT1063447	hsa-miR-4419a	CLIP-seq
MIRT1063450	hsa-miR-4510	CLIP-seq
MIRT2014988	hsa-miR-4735-5p	CLIP-seq
MIRT1063455	hsa-miR-4739	CLIP-seq
MIRT1063457	hsa-miR-4756-5p	CLIP-seq
MIRT2014989	hsa-miR-4775	CLIP-seq
MIRT2247338	hsa-miR-4783-5p	CLIP-seq
MIRT2014991	hsa-miR-483-5p	CLIP-seq
MIRT2451691	hsa-miR-577	CLIP-seq
MIRT2014993	hsa-miR-590-3p	CLIP-seq
MIRT1063471	hsa-miR-877	CLIP-seq
MIRT2550753	hsa-miR-1343	CLIP-seq
MIRT1063426	hsa-miR-150	CLIP-seq
MIRT2014982	hsa-miR-197	CLIP-seq
MIRT2550754	hsa-miR-1976	CLIP-seq
MIRT2014983	hsa-miR-3149	CLIP-seq
MIRT2014985	hsa-miR-411	CLIP-seq
MIRT2014987	hsa-miR-4716-5p	CLIP-seq
MIRT2014988	hsa-miR-4735-5p	CLIP-seq
MIRT2014989	hsa-miR-4775	CLIP-seq
MIRT2247338	hsa-miR-4783-5p	CLIP-seq
MIRT2014991	hsa-miR-483-5p	CLIP-seq
MIRT2550755	hsa-miR-498	CLIP-seq
MIRT2014992	hsa-miR-5096	CLIP-seq
MIRT2014993	hsa-miR-590-3p	CLIP-seq
MIRT2550756	hsa-miR-891b	CLIP-seq
MIRT2550753	hsa-miR-1343	CLIP-seq
MIRT1063426	hsa-miR-150	CLIP-seq
MIRT2014982	hsa-miR-197	CLIP-seq
MIRT2550754	hsa-miR-1976	CLIP-seq
MIRT1063436	hsa-miR-3074-3p	CLIP-seq
MIRT1063437	hsa-miR-3135b	CLIP-seq
MIRT2014983	hsa-miR-3149	CLIP-seq
MIRT1063438	hsa-miR-3652	CLIP-seq
MIRT2014985	hsa-miR-411	CLIP-seq
MIRT1063445	hsa-miR-4253	CLIP-seq
MIRT1063448	hsa-miR-4430	CLIP-seq
MIRT1063453	hsa-miR-4688	CLIP-seq
MIRT2014987	hsa-miR-4716-5p	CLIP-seq
MIRT2014988	hsa-miR-4735-5p	CLIP-seq
MIRT2682724	hsa-miR-4772-3p	CLIP-seq
MIRT2014989	hsa-miR-4775	CLIP-seq
MIRT2247338	hsa-miR-4783-5p	CLIP-seq
MIRT2014991	hsa-miR-483-5p	CLIP-seq
MIRT2550755	hsa-miR-498	CLIP-seq
MIRT2247339	hsa-miR-5095	CLIP-seq
MIRT2014992	hsa-miR-5096	CLIP-seq
MIRT2247340	hsa-miR-552	CLIP-seq
MIRT2014993	hsa-miR-590-3p	CLIP-seq
MIRT2247342	hsa-miR-764	CLIP-seq
MIRT2550756	hsa-miR-891b	CLIP-seq

Transcription factors

Show/Hide all(27)

Transcription factor	Regulation	Reference
ATF1	Activation	10540320
CEBPA	Unknown	12219016
CEBPB	Unknown	12493739
CREB1	Activation	10540320;22140263
CREB1	Unknown	17202341
FLI1	Activation	20879862
FOXP3	Unknown	24315995
GATA3	Unknown	21507199
HDAC11	Repression	19011628
HDAC4	Repression	17610967
IRF1	Activation	12817009
IRF8	Unknown	20709027
MSC	Activation	19561533
NFKB1	Activation	19124729
NFKB1	Unknown	9310124
NR1I2	Activation	22285937
PARP1	Unknown	20181890
PGR	Repression	18685848
REL	Unknown	9310124
RELA	Activation	19124729
SP1	Activation	21309719
SP1	Unknown	11278848;17202341
STAT1	Unknown	20709027
STAT3	Activation	12817009;18765795
STAT3	Unknown	10903771;15034082;17404037;18403020;19124156
TBX21	Unknown	21507199
VDR	Repression	20691220

Show/Hide all(86)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001818	Process	Negative regulation of cytokine production	IDA	1940799
GO:0001819	Process	Positive regulation of cytokine production	IDA	10443688
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0002237	Process	Response to molecule of bacterial origin	IDA	17449476
GO:0002639	Process	Positive regulation of immunoglobulin production	IGI	22962438
GO:0002719	Process	Negative regulation of cytokine production involved in immune response	IDA	10443688
GO:0002875	Process	Negative regulation of chronic inflammatory response to antigenic stimulus	IEA
GO:0002904	Process	Positive regulation of B cell apoptotic process	IDA	9184696
GO:0005125	Function	Cytokine activity	NAS	10443688
GO:0005141	Function	Interleukin-10 receptor binding	NAS	1847510
GO:0005515	Function	Protein binding	IPI	11485736, 12513909, 15837194, 16982608, 20462497, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	10443688, 21323571
GO:0007253	Process	Cytoplasmic sequestering of NF-kappaB	NAS	10975994
GO:0007568	Process	Aging	IEA
GO:0008083	Function	Growth factor activity	NAS	1371884
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0010468	Process	Regulation of gene expression	IDA	9184696
GO:0010507	Process	Negative regulation of autophagy	IDA	26962683
GO:0014823	Process	Response to activity	IEA
GO:0014854	Process	Response to inactivity	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0030097	Process	Hemopoiesis	TAS	11244051
GO:0030183	Process	B cell differentiation	NAS	8228801
GO:0030595	Process	Leukocyte chemotaxis	TAS	9405662
GO:0030886	Process	Negative regulation of myeloid dendritic cell activation	IEA
GO:0030889	Process	Negative regulation of B cell proliferation	IDA	9184696
GO:0032687	Process	Negative regulation of interferon-alpha production	NAS	9637497
GO:0032689	Process	Negative regulation of interferon-gamma production	IEA
GO:0032692	Process	Negative regulation of interleukin-1 production	TAS	19262501
GO:0032695	Process	Negative regulation of interleukin-12 production	TAS	19262501
GO:0032701	Process	Negative regulation of interleukin-18 production	TAS	19262501
GO:0032715	Process	Negative regulation of interleukin-6 production	IDA	10443688
GO:0032715	Process	Negative regulation of interleukin-6 production	TAS	19262501
GO:0032717	Process	Negative regulation of interleukin-8 production	TAS	19262501
GO:0032720	Process	Negative regulation of tumor necrosis factor production	TAS	19262501
GO:0032868	Process	Response to insulin	IEA
GO:0034115	Process	Negative regulation of heterotypic cell-cell adhesion	ISS
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	ISS
GO:0034465	Process	Response to carbon monoxide	IEA
GO:0035722	Process	Interleukin-12-mediated signaling pathway	TAS
GO:0035729	Process	Cellular response to hepatocyte growth factor stimulus	IEA
GO:0042092	Process	Type 2 immune response	TAS	11244051
GO:0042100	Process	B cell proliferation	NAS	8228801
GO:0042130	Process	Negative regulation of T cell proliferation	NAS	8499633, 14971032
GO:0042493	Process	Response to drug	IEA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042832	Process	Defense response to protozoan	IEA
GO:0043032	Process	Positive regulation of macrophage activation	IEA
GO:0043066	Process	Negative regulation of apoptotic process	NAS	8312229
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	IEA
GO:0045191	Process	Regulation of isotype switching	NAS	8228801
GO:0045347	Process	Negative regulation of MHC class II biosynthetic process	IDA	1940799
GO:0045347	Process	Negative regulation of MHC class II biosynthetic process	TAS	11244051
GO:0045348	Process	Positive regulation of MHC class II biosynthetic process	IEA
GO:0045787	Process	Positive regulation of cell cycle	IEA
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	7749983, 16606666
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IMP	17875732
GO:0045930	Process	Negative regulation of mitotic cell cycle	ISS
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IDA	16982608
GO:0046983	Function	Protein dimerization activity	IDA	16982608
GO:0050728	Process	Negative regulation of inflammatory response	IDA	10443688
GO:0050728	Process	Negative regulation of inflammatory response	NAS	21857966
GO:0050807	Process	Regulation of synapse organization	IEA
GO:0051045	Process	Negative regulation of membrane protein ectodomain proteolysis	IDA	18383040
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	7749983
GO:0051384	Process	Response to glucocorticoid	IDA	10443688
GO:0060302	Process	Negative regulation of cytokine activity	IMP	9847016
GO:0060670	Process	Branching involved in labyrinthine layer morphogenesis	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	NAS	14971032
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0071650	Process	Negative regulation of chemokine (C-C motif) ligand 5 production	TAS	19262501
GO:0072577	Process	Endothelial cell apoptotic process	ISS
GO:0097421	Process	Liver regeneration	IEA
GO:1900100	Process	Positive regulation of plasma cell differentiation	IGI	22962438
GO:1902895	Process	Positive regulation of pri-miRNA transcription by RNA polymerase II	IEA
GO:1903034	Process	Regulation of response to wounding	ISS
GO:1903208	Process	Negative regulation of hydrogen peroxide-induced neuron death	ISS
GO:1903659	Process	Regulation of complement-dependent cytotoxicity	IMP	16034134
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IEA
GO:1904057	Process	Negative regulation of sensory perception of pain	IEA
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	ISS
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	ISS
GO:2000273	Process	Positive regulation of signaling receptor activity	IDA	10443688
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IMP	16034134

MIM	HGNC	e!Ensembl
124092	5962	ENSG00000136634

Protein

UniProt ID

P22301

Protein name

Interleukin-10 (IL-10) (Cytokine synthesis inhibitory factor) (CSIF)

Protein function

Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric rec

PDB

1ILK , 1INR , 1J7V , 1LK3 , 1Y6K , 2H24 , 2ILK , 6X93 , 8SVE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00726	IL10	5 → 174	Interleukin 10	Domain

Sequence

MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ
LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLR
LRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Sequence length

178

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412