GediPNet logo

IKBKG (inhibitor of nuclear factor kappa B kinase regulatory subunit gamma)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8517
Gene nameGene Name - the full gene name approved by the HGNC.
Inhibitor of nuclear factor kappa B kinase regulatory subunit gamma
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
IKBKG
SynonymsGene synonyms aliases
AMCBX1, EDAID1, FIP-3, FIP3, Fip3p, IKK-gamma, IKKAP1, IKKG, IMD33, IP, IP1, IP2, IPD2, NEMO, ZC2HC9
ChromosomeChromosome number
X
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq28
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immunity, cell survival, and other pathways. Mutations in this gene result in incontinentia pigmenti, hypohidrotic ectodermal dysplasia, and several other types of immunodeficiencies. A pseudogene highly similar to this locus is located in an adjacent region of the X chromosome. [provided by RefSeq, Mar 2016]
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs137853321 A>G Pathogenic Terminator codon variant, non coding transcript variant, stop lost
rs137853322 A>G Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs137853323 C>T Pathogenic Coding sequence variant, non coding transcript variant, stop gained
rs137853324 G>T Pathogenic Coding sequence variant, non coding transcript variant, stop gained
rs137853325 T>C Pathogenic Coding sequence variant, non coding transcript variant, missense variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT051313 hsa-miR-15a-5p CLASH 23622248
MIRT498936 hsa-miR-8085 PAR-CLIP 24398324
MIRT498937 hsa-miR-6731-5p PAR-CLIP 24398324
MIRT498938 hsa-miR-6878-5p PAR-CLIP 24398324
MIRT498939 hsa-miR-4306 PAR-CLIP 24398324
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IPI 17314283
GO:0000187 Process Activation of MAPK activity TAS
GO:0000922 Component Spindle pole IDA 24561039
GO:0002223 Process Stimulatory C-type lectin receptor signaling pathway TAS
GO:0002479 Process Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent TAS
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q9Y6K9
Protein name NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier)
Protein function Regulatory subunit of the IKK core complex which phosphorylates inhibitors of NF-kappa-B thus leading to the dissociation of the inhibitor/NF-kappa-B complex and ultimately the degradation of the inhibitor (PubMed:9751060, PubMed:14695475, PubMed:20724660). Its binding to scaffolding polyubiquitin plays a key role in IKK activation by multiple signaling receptor pathways (PubMed:16547522, PubMed:18287044, PubMed:19033441, PubMed:21606507, PubMed:27777308, PubMed:19185524). Can recognize and bind both 'Lys-63'-linked and linear polyubiquitin upon cell stimulation, with a much highr affinity for linear polyubiquitin (PubMed:16547522, PubMed:18287044, PubMed:27777308, PubMed:19033441, PubMed:21606507, PubMed:19185524). Could be implicated in NF-kappa-B-mediated protection from cytokine toxicity. Essential for viral activation of IRF3 (PubMed:19854139). Involved in TLR3- and IFIH1-mediated antiviral innate response; this function requires 'Lys-27'-linked polyubiquitination (PubMed:20724660). ; (Microbial infection) Also considered to be a mediator for HTLV-1 Tax oncoprotein activation of NF-kappa-B.
PDB 2JVX , 2JVY , 3BRT , 3BRV , 3CL3 , 3FX0 , 4BWN , 5AAY , 5LDE , 6MI3 , 6MI4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11577 NEMO
44 111
NF-kappa-B essential modulator NEMO
Family
PF16516 CC2-LZ
247 344
Leucine zipper of domain CC2 of NEMO, NF-kappa-B essential modulator
Coiled-coil
PF18414 zf_C2H2_10
393 418
Domain
Sequence
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE
LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEK
LDLKRQKEQ
ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLK
ASCQESARIEDMRKRH
VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Sequence length 419
Interactions View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412