IFNB1 (interferon beta 1)

Gene

• Entrez ID: 3456
• Gene name: Interferon beta 1
• Gene symbol: IFNB1
• Synonyms: IFB, IFF, IFN-beta, IFNB
• Chromosome: 9
• Chromosome location: 9p21.3
• Summary: This gene encodes a cytokine that belongs to the interferon family of signaling proteins, which are released as part of the innate immune response to pathogens. The protein encoded by this gene belongs to the type I class of interferons, which are importa

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004614	hsa-let-7b-5p	ELISA, Luciferase reporter assay, qRT-PCR	20130213
MIRT004615	hsa-miR-26a-5p	ELISA, Luciferase reporter assay, qRT-PCR	20130213
MIRT004616	hsa-miR-145-5p	ELISA, Luciferase reporter assay, qRT-PCR	20130213
MIRT004617	hsa-miR-34a-5p	ELISA, Luciferase reporter assay, qRT-PCR	20130213
MIRT644955	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT644954	hsa-miR-4282	HITS-CLIP	23824327
MIRT644953	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT644952	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT644951	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT644950	hsa-miR-8063	HITS-CLIP	23824327
MIRT644949	hsa-miR-4698	HITS-CLIP	23824327
MIRT644948	hsa-miR-6080	HITS-CLIP	23824327
MIRT644947	hsa-miR-607	HITS-CLIP	23824327
MIRT736422	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT004616	hsa-miR-145-5p	Western blotting, qRT-PCR, ELISA	32808389
MIRT644955	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT644954	hsa-miR-4282	HITS-CLIP	23824327
MIRT644953	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT644952	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT644951	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT644950	hsa-miR-8063	HITS-CLIP	23824327
MIRT644949	hsa-miR-4698	HITS-CLIP	23824327
MIRT644948	hsa-miR-6080	HITS-CLIP	23824327
MIRT644947	hsa-miR-607	HITS-CLIP	23824327

Transcription factors

Transcription factor	Regulation	Reference
ATF2	Activation	17496231
ATF2	Unknown	10848607
IRF1	Activation	8021262
IRF1	Unknown	17073600;18575764;22547704
IRF2	Activation	8021262
IRF2	Unknown	17073600
IRF3	Activation	12077266;17496231;23096996
IRF3	Unknown	10848607;15955070;16125763;17079305;19541850;20048166;20453844;20483755
IRF7	Activation	17236232
IRF7	Repression	22698399
IRF7	Unknown	22547704;23906644
JUN	Unknown	10848607
NFKB1	Activation	10074115;12077266;17496231
NFKB1	Unknown	15955070;16125763;17079305
NFKBIA	Repression	10074115
NFKBIB	Repression	10074115
PML	Activation	11042692
RELA	Activation	10074115;12077266;17496231
RELA	Unknown	15955070;16125763;17079305;22547704
STAT1	Repression	19096445
YY1	Unknown	22065573

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IBA	21873635
GO:0002286	Process	T cell activation involved in immune response	IBA	21873635
GO:0002312	Process	B cell activation involved in immune response	IMP	12932356
GO:0002323	Process	Natural killer cell activation involved in immune response	IBA	21873635
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005125	Function	Cytokine activity	IDA	19008854
GO:0005132	Function	Type I interferon receptor binding	IBA	21873635
GO:0005132	Function	Type I interferon receptor binding	NAS	2414376
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006959	Process	Humoral immune response	IBA	21873635
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	10640778
GO:0007596	Process	Blood coagulation	TAS
GO:0008811	Function	Chloramphenicol O-acetyltransferase activity	IMP	19176627
GO:0009615	Process	Response to virus	NAS	12120696
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0030101	Process	Natural killer cell activation	NAS	11987821
GO:0030183	Process	B cell differentiation	IBA	21873635
GO:0033141	Process	Positive regulation of peptidyl-serine phosphorylation of STAT protein	IBA	21873635
GO:0033141	Process	Positive regulation of peptidyl-serine phosphorylation of STAT protein	IDA	18035482
GO:0035458	Process	Cellular response to interferon-beta	IDA	18035482
GO:0042100	Process	B cell proliferation	IBA	21873635
GO:0042100	Process	B cell proliferation	NAS	3135963
GO:0043330	Process	Response to exogenous dsRNA	IBA	21873635
GO:0043330	Process	Response to exogenous dsRNA	IDA	21266579
GO:0045071	Process	Negative regulation of viral genome replication	IDA	19008854
GO:0045089	Process	Positive regulation of innate immune response	NAS	11987821
GO:0045343	Process	Regulation of MHC class I biosynthetic process	NAS	8805651
GO:0045581	Process	Negative regulation of T cell differentiation	IDA	20554961
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18035482
GO:0051607	Process	Defense response to virus	TAS	19416887
GO:0060337	Process	Type I interferon signaling pathway	IDA	18035482
GO:0060337	Process	Type I interferon signaling pathway	TAS
GO:0071360	Process	Cellular response to exogenous dsRNA	TAS	21266579
GO:2000552	Process	Negative regulation of T-helper 2 cell cytokine production	IDA	20554961
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IDA	10918594, 11337497

Other IDs

• MIM: 147640
• HGNC: 5434
• e!Ensembl: ENSG00000171855

Protein

• UniProt ID: P01574
• Protein name: Interferon beta (IFN-beta) (Fibroblast interferon)
• Protein function: Type I interferon cytokine that plays a key role in the innate immune response to infection, developing tumors and other inflammatory stimuli (PubMed:10049744, PubMed:10556041, PubMed:6157094, PubMed:6171735, PubMed:7665574, PubMed:8027027, PubM
• PDB: 1AU1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00143	Interferon	27 → 185	Interferon alpha/beta domain	Domain

• Sequence:

  MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFD
  IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK
  TVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR
  LTGYLRN

• Sequence length: 187