IFNA10 (interferon alpha 10)

Gene

• Entrez ID: 3446
• Gene name: Interferon alpha 10
• Gene symbol: IFNA10
• Synonyms: IFN-alphaC
• Chromosome: 9
• Chromosome location: 9p21.3
• Summary: This gene encodes a protein that belongs to the type I interferon family of proteins, and is located in a cluster of alpha interferon genes on chromosome 9. Interferons are small regulatory molecules that function in cell signaling in response to viruses and other pathogens or tumor cells. This gene is intronless and the encoded protein is secreted. [provided by RefSeq, Aug 2013]

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IBA	21873635
GO:0002286	Process	T cell activation involved in immune response	IBA	21873635
GO:0002323	Process	Natural killer cell activation involved in immune response	IBA	21873635
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005132	Function	Type I interferon receptor binding	IBA	21873635
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006959	Process	Humoral immune response	IBA	21873635
GO:0007596	Process	Blood coagulation	TAS
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0030183	Process	B cell differentiation	IBA	21873635
GO:0033141	Process	Positive regulation of peptidyl-serine phosphorylation of STAT protein	IBA	21873635
GO:0042100	Process	B cell proliferation	IBA	21873635
GO:0043330	Process	Response to exogenous dsRNA	IBA	21873635
GO:0051607	Process	Defense response to virus	IEA
GO:0060337	Process	Type I interferon signaling pathway	TAS

Other IDs

• MIM: 147577
• HGNC: 5418
• e!Ensembl: ENSG00000186803

Protein

• UniProt ID: P01566
• Protein name: Interferon alpha-10 (IFN-alpha-10) (Interferon alpha-6L) (Interferon alpha-C) (LeIF C)
• Protein function: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00143	Interferon	26 → 185	Interferon alpha/beta domain	Domain

• Sequence:

  MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFR
  IPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE
  ACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTN
  LQKRLRRKD

• Sequence length: 189