IFNA1 (interferon alpha 1)

Gene

• Entrez ID: 3439
• Gene name: Interferon alpha 1
• Gene symbol: IFNA1
• Synonyms: IFL, IFN, IFN-ALPHA, IFN-alphaD, IFNA13, IFNA@, leIF D
• Chromosome: 9
• Chromosome location: 9p21.3
• Summary: This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded cytokine is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. This cytokine is upregulated in preeclamptic placentas and is thought to be a mediator of preeclampsia. [provided by RefSeq, Aug 2020]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023373	hsa-miR-122-5p	Microarray	17612493
MIRT734504	hsa-miR-503-3p	ELISA, qRT-PCR, MTT	26580839

Transcription factors

Transcription factor	Regulation	Reference
BRCA1	Activation	17374731
HDAC3	Repression	22685561
IRF1	Activation	12077266
IRF1	Unknown	7606736
IRF3	Activation	12242290
IRF3	Unknown	15331713
IRF5	Activation	17301153
IRF7	Activation	12077266;12242290;21670437
MYC	Repression	16270532
NFKB1	Activation	8035474
NFKB1	Unknown	15331713
PITX1	Repression	12242290
RELA	Activation	8035474
RELA	Unknown	15331713
STAT1	Repression	18616672
STAT1	Unknown	17050680
STAT2	Unknown	15827155

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IBA	21873635
GO:0002286	Process	T cell activation involved in immune response	IBA	21873635
GO:0002323	Process	Natural killer cell activation involved in immune response	IBA	21873635
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005132	Function	Type I interferon receptor binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006959	Process	Humoral immune response	IBA	21873635
GO:0007596	Process	Blood coagulation	TAS
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0030183	Process	B cell differentiation	IBA	21873635
GO:0033141	Process	Positive regulation of peptidyl-serine phosphorylation of STAT protein	IBA	21873635
GO:0042100	Process	B cell proliferation	IBA	21873635
GO:0043330	Process	Response to exogenous dsRNA	IBA	21873635
GO:0051607	Process	Defense response to virus	IEA
GO:0060337	Process	Type I interferon signaling pathway	TAS

Other IDs

• MIM: 147660
• HGNC: 5417
• e!Ensembl: ENSG00000197919

Protein

• UniProt ID: P01562
• Protein name: Interferon alpha-1/13 (IFN-alpha-1/13) (Interferon alpha-D) (LeIF D)
• Protein function: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
• PDB: 3UX9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00143	Interferon	26 → 185	Interferon alpha/beta domain	Domain

• Sequence:

  MASPFALLMVLVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFG
  FPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLE
  ACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTN
  LQERLRRKE

• Sequence length: 189