IDO2 (indoleamine 2,3-dioxygenase 2)

Gene

• Entrez ID: 169355
• Gene name: Indoleamine 2,3-dioxygenase 2
• Gene symbol: IDO2
• Synonyms: INDOL1
• Chromosome: 8
• Chromosome location: 8p11.21
• Summary: Along with the enzymes encoded by the INDO (MIM 147435) and TDO2 (MIM 191070) genes, the enzyme encoded by the INDOL1 gene metabolizes tryptophan in the kynurenine pathway (Ball et al., 2007 [PubMed 17499941]).[supplied by OMIM, Feb 2011]

Transcription factors

Transcription factor	Regulation	Reference
PTMA	Activation	21176371;21575365

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0004833	Function	Tryptophan 2,3-dioxygenase activity	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	ISS	17499941
GO:0005829	Component	Cytosol	TAS
GO:0006569	Process	Tryptophan catabolic process	TAS
GO:0019441	Process	Tryptophan catabolic process to kynurenine	IBA	21873635
GO:0019441	Process	Tryptophan catabolic process to kynurenine	IDA	17671174
GO:0019441	Process	Tryptophan catabolic process to kynurenine	IEA
GO:0019441	Process	Tryptophan catabolic process to kynurenine	ISS	17499941
GO:0020037	Function	Heme binding	IEA
GO:0033754	Function	Indoleamine 2,3-dioxygenase activity	IBA	21873635
GO:0033754	Function	Indoleamine 2,3-dioxygenase activity	IDA	17671174
GO:0033754	Function	Indoleamine 2,3-dioxygenase activity	ISS	17499941
GO:0034354	Process	'de novo' NAD biosynthetic process from tryptophan	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 612129
• HGNC: 27269
• e!Ensembl: ENSG00000188676

Protein

• UniProt ID: Q6ZQW0
• Protein name: Indoleamine 2,3-dioxygenase 2 (IDO-2) (EC 1.13.11.-) (Indoleamine 2,3-dioxygenase-like protein 1) (Indoleamine-pyrrole 2,3-dioxygenase-like protein 1)
• Protein function: Catalyzes the first and rate limiting step of the catabolism of the essential amino acid tryptophan along the kynurenine pathway (PubMed:17671174). Involved in immune regulation. May not play a significant role in tryptophan-related tumoral resistance (PubMed:25691885).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01231	IDO	28 → 414	Indoleamine 2,3-dioxygenase	Family

• Sequence:

  MLHFHYYDTSNKIMEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIA
  NKLPQLIDAHQLQAHVDKMPLLSCQFLKGHREQRLAHLVLSFLTMGYVWQEGEAQPAEVL
  PRNLALPFVEVSRNLGLPPILVHSDLVLTNWTKKDPDGFLEIGNLETIISFPGGESLHGF
  ILVTALVEKEAVPGIKALVQATNAILQPNQEALLQALQRLRLSIQDITKTLGQMHDYVDP
  DIFYAGIRIFLSGWKDNPAMPAGLMYEGVSQEPLKYSGGSAAQSTVLHAFDEFLGIRHSK
  ESGDFLYRMRDYMPPSHKAFIEDIHSAPSLRDYILSSGQDHLLTAYNQCVQALAELRSYH
  ITMVTKYLITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILHPRG
  

• Sequence length: 420