IDH3G (isocitrate dehydrogenase (NAD(+)) 3 non-catalytic subunit gamma)

Gene

• Entrez ID: 3421
• Gene name: Isocitrate dehydrogenase (NAD(+)) 3 non-catalytic subunit gamma
• Gene symbol: IDH3G
• Synonyms: H-IDHG, RP99
• Chromosome: X
• Chromosome location: Xq28
• Summary: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT044581	hsa-miR-320a	CLASH	23622248
MIRT2246020	hsa-miR-4514	CLIP-seq
MIRT2246021	hsa-miR-4692	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000287	Function	Magnesium ion binding	IDA	28098230
GO:0004449	Function	Isocitrate dehydrogenase (NAD+) activity	IBA	21873635
GO:0004449	Function	Isocitrate dehydrogenase (NAD+) activity	ISS
GO:0005515	Function	Protein binding	IPI	14555658, 28098230, 28514442
GO:0005524	Function	ATP binding	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005739	Component	Mitochondrion	IBA	21873635
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	ISS
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005975	Process	Carbohydrate metabolic process	NAS	9286695
GO:0006099	Process	Tricarboxylic acid cycle	IBA	21873635
GO:0006099	Process	Tricarboxylic acid cycle	TAS
GO:0006102	Process	Isocitrate metabolic process	IBA	21873635
GO:0006102	Process	Isocitrate metabolic process	ISS
GO:0051287	Function	NAD binding	IEA

Other IDs

• MIM: 300089
• HGNC: 5386
• e!Ensembl: ENSG00000067829

Protein

• UniProt ID: P51553
• Protein name: Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial (Isocitric dehydrogenase subunit gamma) (NAD(+)-specific ICDH subunit gamma)
• Protein function: Regulatory subunit which plays a role in the allosteric regulation of the enzyme catalyzing the decarboxylation of isocitrate (ICT) into alpha-ketoglutarate. The heterodimer composed of the alpha (IDH3A) and beta (IDH3B) subunits and the heterod
• PDB: 5GRE, 5GRF, 5GRH, 5GRI, 5GRL, 5YVT, 6L57, 6L59, 7CE3, 8GRG, 8GRH, 8GS5
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00180	Iso_dh	56 → 382	Isocitrate/isopropylmalate dehydrogenase	Domain

• Sequence:

  MALKVATVAGSAAKAVLGPALLCRPWEVLGAHEVPSRNIFSEQTIPPSAKYGGRHTVTMI
  PGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIET
  NHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHE
  SVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVA
  ARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYG
  HVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNEN
  MHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA

• Sequence length: 393