IDH3B (isocitrate dehydrogenase (NAD(+)) 3 non-catalytic subunit beta)

Gene

• Entrez ID: 3420
• Gene name: Isocitrate dehydrogenase (NAD(+)) 3 non-catalytic subunit beta
• Gene symbol: IDH3B
• Synonyms: RP46
• Chromosome: 20
• Chromosome location: 20p13
• Summary: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs137853020	A>G	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs191680997	G>A,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance, benign	Intron variant
rs747812567	G>-	Likely-pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant
rs776399707	C>T	Conflicting-interpretations-of-pathogenicity	Non coding transcript variant, coding sequence variant, synonymous variant
rs1600169350	T>-	Pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT043662	hsa-miR-342-3p	CLASH	23622248
MIRT040424	hsa-miR-615-3p	CLASH	23622248
MIRT035766	hsa-miR-103a-2-5p	CLASH	23622248
MIRT717080	hsa-miR-4709-5p	HITS-CLIP	19536157
MIRT717081	hsa-miR-6884-3p	HITS-CLIP	19536157
MIRT717079	hsa-miR-197-3p	HITS-CLIP	19536157
MIRT717080	hsa-miR-4709-5p	HITS-CLIP	19536157
MIRT717081	hsa-miR-6884-3p	HITS-CLIP	19536157
MIRT717079	hsa-miR-197-3p	HITS-CLIP	19536157

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000287	Function	Magnesium ion binding	IEA
GO:0004449	Function	Isocitrate dehydrogenase (NAD+) activity	IBA	21873635
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005739	Component	Mitochondrion	IBA	21873635
GO:0005739	Component	Mitochondrion	IDA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006099	Process	Tricarboxylic acid cycle	IBA	21873635
GO:0006099	Process	Tricarboxylic acid cycle	TAS
GO:0006102	Process	Isocitrate metabolic process	IBA	21873635
GO:0009055	Function	Electron transfer activity	TAS	10601238
GO:0022900	Process	Electron transport chain	IEA
GO:0051287	Function	NAD binding	IEA

Other IDs

• MIM: 604526
• HGNC: 5385
• e!Ensembl: ENSG00000101365

Protein

• UniProt ID: O43837
• Protein name: Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial (Isocitric dehydrogenase subunit beta) (NAD(+)-specific ICDH subunit beta)
• Protein function: Plays a structural role to facilitate the assembly and ensure the full activity of the enzyme catalyzing the decarboxylation of isocitrate (ICT) into alpha-ketoglutarate. The heterodimer composed of the alpha (IDH3A) and beta (IDH3B) subunits an
• PDB: 6KDE, 6KDF, 6KDY, 6KE3, 7CE3, 8GRB, 8GRD, 8GRU, 8GS5
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00180	Iso_dh	50 → 376	Isocitrate/isopropylmalate dehydrogenase	Domain

• Sequence:

  MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVG
  PELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPME
  YKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESAR
  GVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELY
  PKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEY
  AVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRT
  RDMGGYSTTTDFIKSVIGHLQTKGS

• Sequence length: 385