ICAM1 (intercellular adhesion molecule 1)

Gene

• Entrez ID: 3383
• Gene name: Intercellular adhesion molecule 1
• Gene symbol: ICAM1
• Synonyms: BB2, CD54, P3.58
• Chromosome: 19
• Chromosome location: 19p13.2
• Summary: This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor. [provided by RefSeq, Jul 2008]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs5491	A>G,T	Risk-factor	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004020	hsa-miR-17-3p	Immunocytochemistry, Northern blot, qRT-PCR, Western blot	19949084
MIRT004020	hsa-miR-17-3p	Luciferase reporter assay, Western blot	26935986
MIRT004430	hsa-miR-221-3p	Luciferase reporter assay, Western blot	20110463
MIRT004430	hsa-miR-221-3p	Luciferase reporter assay	19949084
MIRT004430	hsa-miR-221-3p	Luciferase reporter assay	28338009
MIRT004595	hsa-miR-222-3p	Luciferase reporter assay	19949084
MIRT004595	hsa-miR-222-3p	Luciferase reporter assay	28338009
MIRT005707	hsa-miR-31-5p	Luciferase reporter assay	19949084
MIRT005708	hsa-miR-17-5p	Luciferase reporter assay	19949084
MIRT005709	hsa-miR-155-5p	Luciferase reporter assay	19949084
MIRT005709	hsa-miR-155-5p	qRT-PCR	21310411
MIRT005710	hsa-miR-1256	Luciferase reporter assay	19949084
MIRT005952	hsa-miR-21-5p	Luciferase reporter assay, Microarray, qRT-PCR	21131358
MIRT018131	hsa-miR-335-5p	Microarray	18185580
MIRT027615	hsa-miR-98-5p	Microarray	19088304
MIRT054646	hsa-miR-296-3p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24263102
MIRT054757	hsa-miR-146a-5p	QRTPCR, Western blot	24867582
MIRT149142	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT149176	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT438035	hsa-miR-93-5p	qRT-PCR	24367666
MIRT438044	hsa-miR-324-3p	qRT-PCR	24367666
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	19536157
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	19536157
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	19536157
MIRT611889	hsa-miR-3188	HITS-CLIP	23824327
MIRT611890	hsa-miR-2467-5p	HITS-CLIP	23824327
MIRT611891	hsa-miR-3975	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	19536157
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	19536157
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	19536157
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	19536157
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	19536157
MIRT635763	hsa-miR-466	HITS-CLIP	23824327
MIRT635764	hsa-miR-4643	HITS-CLIP	23824327
MIRT727474	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT727475	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT727476	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT734555	hsa-miR-141-5p	Luciferase reporter assay	26371161

Transcription factors

Transcription factor	Regulation	Reference
CEBPA	Unknown	9916895
ERG	Repression	22235125
ETS2	Activation	9572487
ETV5	Activation	9572487
HDAC1	Activation	12490396
IFI16	Repression	17699163
MYB	Repression	21953443
NFATC1	Activation	19351910
NFKB1	Activation	10092659;10946302;11463837;11877286;16317091;16385502;17121934;19074768;20173029;22001597;22708120;9733827;9916895
NFKB1	Unknown	10738944;10837365;10926553;11198351;11401521;12490396;12691701;15480988;15800027;15843586;16105834;16453001;18285351;18928584;20103608;9192770
NFKBIA	Repression	12490396;9733827;9990039
PPARG	Repression	17425601
RARA	Activation	1355009
RARG	Activation	1355009
REL	Unknown	10706725;10837365;10926553
RELA	Activation	10092659;10946302;11463837;11877286;16317091;16385502;17121934;19074768;19351910;20173029;22001597;22708120;9733827;9888295;9916895
RELA	Unknown	10228026;10837365;10926553;11401521;12490396;12691701;15800027;15843586;16105834;16453001;18285351;18928584;20103608;9192770
SIRT1	Repression	23238746
SP1	Unknown	15480988
STAT1	Activation	12651068;9888295;9990314
STAT3	Unknown	23690481;8675499
TWIST1	Activation	17487558
TWIST2	Activation	17487558

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001618	Function	Virus receptor activity	IEA
GO:0001772	Component	Immunological synapse	IEA
GO:0001910	Process	Regulation of leukocyte mediated cytotoxicity	TAS	16038038
GO:0001975	Process	Response to amphetamine	IEA
GO:0002291	Process	T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IMP	2477710
GO:0002438	Process	Acute inflammatory response to antigenic stimulus	IEA
GO:0002457	Process	T cell antigen processing and presentation	IEA
GO:0002693	Process	Positive regulation of cellular extravasation	IMP	12902516
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	2538243
GO:0005178	Function	Integrin binding	IBA	21873635
GO:0005178	Function	Integrin binding	IDA	23620790
GO:0005178	Function	Integrin binding	IPI	1448173, 12208882
GO:0005515	Function	Protein binding	IPI	7822297, 12526797, 12716892, 16595626, 23858057, 32296183, 32814053
GO:0005615	Component	Extracellular space	IDA	9290466
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007155	Process	Cell adhesion	IBA	21873635
GO:0007155	Process	Cell adhesion	IDA	16809613
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	TAS	2477710
GO:0007159	Process	Leukocyte cell-cell adhesion	IMP	2477710
GO:0007569	Process	Cell aging	IEA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0008360	Process	Regulation of cell shape	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	HDA	19581412, 23981064
GO:0010212	Process	Response to ionizing radiation	IEA
GO:0010477	Process	Response to sulfur dioxide	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0022614	Process	Membrane to membrane docking	IEP	12082081
GO:0030198	Process	Extracellular matrix organization	TAS
GO:0030838	Process	Positive regulation of actin filament polymerization	IEA
GO:0031669	Process	Cellular response to nutrient levels	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0033627	Process	Cell adhesion mediated by integrin	IEA
GO:0034698	Process	Response to gonadotropin	IEA
GO:0038023	Function	Signaling receptor activity	TAS	2538243
GO:0042493	Process	Response to drug	IEA
GO:0043200	Process	Response to amino acid	IEA
GO:0043547	Process	Positive regulation of GTPase activity	IEA
GO:0044406	Process	Adhesion of symbiont to host	IDA	2538243
GO:0045121	Component	Membrane raft	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0046688	Process	Response to copper ion	IEA
GO:0046718	Process	Viral entry into host cell	IEA
GO:0046813	Process	Receptor-mediated virion attachment to host cell	IDA	2538243
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IEA
GO:0050776	Process	Regulation of immune response	TAS
GO:0050900	Process	Leukocyte migration	IEP	12082081
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IEA
GO:0051926	Process	Negative regulation of calcium ion transport	IEA
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:0061028	Process	Establishment of endothelial barrier	IGI	23264465
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	27559042
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0070062	Component	Extracellular exosome	IDA	21276792
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	10903502
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071312	Process	Cellular response to alkaloid	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0071354	Process	Cellular response to interleukin-6	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071549	Process	Cellular response to dexamethasone stimulus	IEA
GO:0072683	Process	T cell extravasation	IEA
GO:0090557	Process	Establishment of endothelial intestinal barrier	IEA
GO:0097368	Process	Establishment of Sertoli cell barrier	IEA
GO:1900027	Process	Regulation of ruffle assembly	IEA
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	10903502
GO:1904646	Process	Cellular response to amyloid-beta	IDA	11078691
GO:1904996	Process	Positive regulation of leukocyte adhesion to vascular endothelial cell	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	10903502

Other IDs

• MIM: 147840
• HGNC: 5344
• e!Ensembl: ENSG00000090339

Protein

• UniProt ID: P05362
• Protein name: Intercellular adhesion molecule 1 (ICAM-1) (Major group rhinovirus receptor) (CD antigen CD54)
• Protein function: ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. ; (Microbial infection) Acts as a receptor for major receptor group rhinovirus A-B capsid proteins. ; (Microbial infection) Acts as a receptor for Coxsackievirus A21 capsid proteins. ; (Microbial infection) Upon Kaposi's sarcoma-associated herpesvirus/HHV-8 infection, is degraded by viral E3 ubiquitin ligase MIR2, presumably to prevent lysis of infected cells by cytotoxic T-lymphocytes and NK cell.
• PDB: 1D3E, 1D3I, 1D3L, 1IAM, 1IC1, 1IJ4, 1MQ8, 1P53, 1Z7Z, 2OZ4, 3TCX, 5MZA, 6EIT, 6S8U
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03921	ICAM_N	24 → 115	Intercellular adhesion molecule (ICAM), N-terminal domain	Domain

• Sequence:

  MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
  ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
  LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH
  GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
  GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
  TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA
  TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
  AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
  IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP

• Sequence length: 532